Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   AB0R74_RS01980 Genome accession   NZ_CP160216
Coordinates   391480..391599 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain JJ1043     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 386480..396599
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R74_RS01965 (AB0R74_01965) - 388092..388775 (+) 684 WP_042634825.1 response regulator transcription factor -
  AB0R74_RS01970 (AB0R74_01970) - 388762..390195 (+) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  AB0R74_RS01975 (AB0R74_01975) rapC 390348..391496 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AB0R74_RS01980 (AB0R74_01980) phrC 391480..391599 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB0R74_RS01985 (AB0R74_01985) - 391747..391842 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  AB0R74_RS01990 (AB0R74_01990) - 391937..393301 (-) 1365 WP_015239155.1 aspartate kinase -
  AB0R74_RS01995 (AB0R74_01995) ceuB 393715..394668 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  AB0R74_RS02000 (AB0R74_02000) - 394658..395605 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  AB0R74_RS02005 (AB0R74_02005) - 395599..396357 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1019362 AB0R74_RS01980 WP_003156334.1 391480..391599(+) (phrC) [Bacillus velezensis strain JJ1043]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1019362 AB0R74_RS01980 WP_003156334.1 391480..391599(+) (phrC) [Bacillus velezensis strain JJ1043]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment