Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB0R79_RS13025 Genome accession   NZ_CP160211
Coordinates   2650489..2650866 (-) Length   125 a.a.
NCBI ID   WP_167340753.1    Uniprot ID   -
Organism   Bacillus velezensis strain JM236     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2645489..2655866
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R79_RS12985 (AB0R79_12985) - 2645987..2646781 (+) 795 WP_015240204.1 YqhG family protein -
  AB0R79_RS12990 (AB0R79_12990) sinI 2646958..2647131 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R79_RS12995 (AB0R79_12995) sinR 2647165..2647500 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R79_RS13000 (AB0R79_13000) tasA 2647548..2648333 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R79_RS13005 (AB0R79_13005) sipW 2648398..2648982 (-) 585 WP_025284996.1 signal peptidase I SipW -
  AB0R79_RS13010 (AB0R79_13010) tapA 2648954..2649625 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R79_RS13015 (AB0R79_13015) - 2649884..2650213 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB0R79_RS13020 (AB0R79_13020) - 2650253..2650432 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R79_RS13025 (AB0R79_13025) comGG 2650489..2650866 (-) 378 WP_167340753.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R79_RS13030 (AB0R79_13030) comGF 2650867..2651367 (-) 501 WP_257720329.1 competence type IV pilus minor pilin ComGF -
  AB0R79_RS13035 (AB0R79_13035) comGE 2651276..2651590 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB0R79_RS13040 (AB0R79_13040) comGD 2651574..2652011 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R79_RS13045 (AB0R79_13045) comGC 2652001..2652309 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R79_RS13050 (AB0R79_13050) comGB 2652314..2653351 (-) 1038 WP_015240211.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R79_RS13055 (AB0R79_13055) comGA 2653338..2654408 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R79_RS13060 (AB0R79_13060) - 2654600..2655550 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14157.10 Da        Isoelectric Point: 9.9599

>NTDB_id=1019016 AB0R79_RS13025 WP_167340753.1 2650489..2650866(-) (comGG) [Bacillus velezensis strain JM236]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFFTRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1019016 AB0R79_RS13025 WP_167340753.1 2650489..2650866(-) (comGG) [Bacillus velezensis strain JM236]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCTTCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment