Detailed information NTG1019017

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R79_RS13040
• Genome accession: NZ_CP160211
• Coordinates: 2651574..2652011 (-)
• Length: 145 a.a.
• NCBI ID: WP_043020787.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JM236
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2646574..2657011

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R79_RS12990 (AB0R79_12990)	sinI	2646958..2647131 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R79_RS12995 (AB0R79_12995)	sinR	2647165..2647500 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R79_RS13000 (AB0R79_13000)	tasA	2647548..2648333 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R79_RS13005 (AB0R79_13005)	sipW	2648398..2648982 (-)	585	WP_025284996.1	signal peptidase I SipW	-
AB0R79_RS13010 (AB0R79_13010)	tapA	2648954..2649625 (-)	672	WP_015240206.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R79_RS13015 (AB0R79_13015)	-	2649884..2650213 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB0R79_RS13020 (AB0R79_13020)	-	2650253..2650432 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R79_RS13025 (AB0R79_13025)	comGG	2650489..2650866 (-)	378	WP_167340753.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R79_RS13030 (AB0R79_13030)	comGF	2650867..2651367 (-)	501	WP_257720329.1	competence type IV pilus minor pilin ComGF	-
AB0R79_RS13035 (AB0R79_13035)	comGE	2651276..2651590 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
AB0R79_RS13040 (AB0R79_13040)	comGD	2651574..2652011 (-)	438	WP_043020787.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R79_RS13045 (AB0R79_13045)	comGC	2652001..2652309 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R79_RS13050 (AB0R79_13050)	comGB	2652314..2653351 (-)	1038	WP_015240211.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R79_RS13055 (AB0R79_13055)	comGA	2653338..2654408 (-)	1071	WP_012117985.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R79_RS13060 (AB0R79_13060)	-	2654600..2655550 (-)	951	WP_032870601.1	magnesium transporter CorA family protein	-
AB0R79_RS13065 (AB0R79_13065)	-	2655696..2657000 (+)	1305	WP_326207138.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16271.77 Da
• Isoelectric Point: 10.2475

>NTDB_id=1019017 AB0R79_RS13040 WP_043020787.1 2651574..2652011(-) (comGD) [Bacillus velezensis strain JM236]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1019017 AB0R79_RS13040 WP_043020787.1 2651574..2652011(-) (comGD) [Bacillus velezensis strain JM236]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566