Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB0R71_RS11920 Genome accession   NZ_CP160210
Coordinates   2472774..2473151 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain JM907     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2467774..2478151
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R71_RS11880 (AB0R71_11885) - 2468271..2469065 (+) 795 WP_136396493.1 YqhG family protein -
  AB0R71_RS11885 (AB0R71_11890) sinI 2469242..2469415 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R71_RS11890 (AB0R71_11895) sinR 2469449..2469784 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R71_RS11895 (AB0R71_11900) tasA 2469832..2470617 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R71_RS11900 (AB0R71_11905) sipW 2470682..2471266 (-) 585 WP_371877457.1 signal peptidase I SipW -
  AB0R71_RS11905 (AB0R71_11910) tapA 2471238..2471909 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R71_RS11910 (AB0R71_11915) - 2472168..2472497 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB0R71_RS11915 (AB0R71_11920) - 2472538..2472717 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R71_RS11920 (AB0R71_11925) comGG 2472774..2473151 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R71_RS11925 (AB0R71_11930) comGF 2473152..2473652 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  AB0R71_RS11930 (AB0R71_11935) comGE 2473561..2473875 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB0R71_RS11935 (AB0R71_11940) comGD 2473859..2474296 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R71_RS11940 (AB0R71_11945) comGC 2474286..2474594 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R71_RS11945 (AB0R71_11950) comGB 2474599..2475636 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R71_RS11950 (AB0R71_11955) comGA 2475623..2476693 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R71_RS11955 (AB0R71_11960) - 2476887..2477837 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1018940 AB0R71_RS11920 WP_012117980.1 2472774..2473151(-) (comGG) [Bacillus velezensis strain JM907]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1018940 AB0R71_RS11920 WP_012117980.1 2472774..2473151(-) (comGG) [Bacillus velezensis strain JM907]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment