Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R71_RS11885 | Genome accession | NZ_CP160210 |
| Coordinates | 2469242..2469415 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JM907 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2464242..2474415
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R71_RS11870 (AB0R71_11875) | gcvT | 2465055..2466155 (-) | 1101 | WP_327975616.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R71_RS11875 (AB0R71_11880) | - | 2466579..2468249 (+) | 1671 | WP_025284995.1 | DEAD/DEAH box helicase | - |
| AB0R71_RS11880 (AB0R71_11885) | - | 2468271..2469065 (+) | 795 | WP_136396493.1 | YqhG family protein | - |
| AB0R71_RS11885 (AB0R71_11890) | sinI | 2469242..2469415 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R71_RS11890 (AB0R71_11895) | sinR | 2469449..2469784 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R71_RS11895 (AB0R71_11900) | tasA | 2469832..2470617 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R71_RS11900 (AB0R71_11905) | sipW | 2470682..2471266 (-) | 585 | WP_371877457.1 | signal peptidase I SipW | - |
| AB0R71_RS11905 (AB0R71_11910) | tapA | 2471238..2471909 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R71_RS11910 (AB0R71_11915) | - | 2472168..2472497 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R71_RS11915 (AB0R71_11920) | - | 2472538..2472717 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R71_RS11920 (AB0R71_11925) | comGG | 2472774..2473151 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R71_RS11925 (AB0R71_11930) | comGF | 2473152..2473652 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R71_RS11930 (AB0R71_11935) | comGE | 2473561..2473875 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R71_RS11935 (AB0R71_11940) | comGD | 2473859..2474296 (-) | 438 | WP_052827646.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1018938 AB0R71_RS11885 WP_003153105.1 2469242..2469415(+) (sinI) [Bacillus velezensis strain JM907]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1018938 AB0R71_RS11885 WP_003153105.1 2469242..2469415(+) (sinI) [Bacillus velezensis strain JM907]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |