Detailed information NTG1018941

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R71_RS11935
• Genome accession: NZ_CP160210
• Coordinates: 2473859..2474296 (-)
• Length: 145 a.a.
• NCBI ID: WP_052827646.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JM907
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2468859..2479296

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R71_RS11885 (AB0R71_11890)	sinI	2469242..2469415 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R71_RS11890 (AB0R71_11895)	sinR	2469449..2469784 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R71_RS11895 (AB0R71_11900)	tasA	2469832..2470617 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R71_RS11900 (AB0R71_11905)	sipW	2470682..2471266 (-)	585	WP_371877457.1	signal peptidase I SipW	-
AB0R71_RS11905 (AB0R71_11910)	tapA	2471238..2471909 (-)	672	WP_015240206.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R71_RS11910 (AB0R71_11915)	-	2472168..2472497 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB0R71_RS11915 (AB0R71_11920)	-	2472538..2472717 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R71_RS11920 (AB0R71_11925)	comGG	2472774..2473151 (-)	378	WP_012117980.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R71_RS11925 (AB0R71_11930)	comGF	2473152..2473652 (-)	501	WP_257474763.1	competence type IV pilus minor pilin ComGF	-
AB0R71_RS11930 (AB0R71_11935)	comGE	2473561..2473875 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
AB0R71_RS11935 (AB0R71_11940)	comGD	2473859..2474296 (-)	438	WP_052827646.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R71_RS11940 (AB0R71_11945)	comGC	2474286..2474594 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R71_RS11945 (AB0R71_11950)	comGB	2474599..2475636 (-)	1038	WP_012117984.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R71_RS11950 (AB0R71_11955)	comGA	2475623..2476693 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R71_RS11955 (AB0R71_11960)	-	2476887..2477837 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
AB0R71_RS11960 (AB0R71_11965)	-	2477983..2479284 (+)	1302	WP_021494315.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16263.70 Da
• Isoelectric Point: 10.2475

>NTDB_id=1018941 AB0R71_RS11935 WP_052827646.1 2473859..2474296(-) (comGD) [Bacillus velezensis strain JM907]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAENKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1018941 AB0R71_RS11935 WP_052827646.1 2473859..2474296(-) (comGD) [Bacillus velezensis strain JM907]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAAAATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572