Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABVR74_RS07990 | Genome accession | NZ_CP159484 |
| Coordinates | 1604535..1604969 (-) | Length | 144 a.a. |
| NCBI ID | WP_353891617.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain CBA3648 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1570969..1610122 | 1604535..1604969 | within | 0 |
Gene organization within MGE regions
Location: 1570969..1610122
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABVR74_RS07810 (ABVR74_07810) | - | 1570969..1571478 (-) | 510 | WP_003131379.1 | hypothetical protein | - |
| ABVR74_RS07820 (ABVR74_07820) | - | 1573543..1574718 (-) | 1176 | WP_353891592.1 | restriction endonuclease subunit S | - |
| ABVR74_RS07825 (ABVR74_07825) | - | 1574708..1576753 (-) | 2046 | WP_353891593.1 | N-6 DNA methylase | - |
| ABVR74_RS07830 (ABVR74_07830) | - | 1576857..1577033 (-) | 177 | WP_353891594.1 | hypothetical protein | - |
| ABVR74_RS07835 (ABVR74_07835) | - | 1577160..1577891 (-) | 732 | WP_353891595.1 | peptidoglycan amidohydrolase family protein | - |
| ABVR74_RS07840 (ABVR74_07840) | - | 1577888..1578235 (-) | 348 | WP_353891596.1 | hypothetical protein | - |
| ABVR74_RS07845 (ABVR74_07845) | - | 1578232..1578648 (-) | 417 | WP_227149993.1 | phage holin family protein | - |
| ABVR74_RS07850 (ABVR74_07850) | - | 1578661..1578891 (-) | 231 | WP_227149994.1 | hypothetical protein | - |
| ABVR74_RS07855 (ABVR74_07855) | - | 1578903..1582292 (-) | 3390 | WP_353891597.1 | phage tail spike protein | - |
| ABVR74_RS07860 (ABVR74_07860) | - | 1582292..1583932 (-) | 1641 | WP_353891598.1 | distal tail protein Dit | - |
| ABVR74_RS07865 (ABVR74_07865) | - | 1583929..1587900 (-) | 3972 | WP_353891599.1 | phage tail tape measure protein | - |
| ABVR74_RS07870 (ABVR74_07870) | - | 1588010..1588807 (-) | 798 | WP_227149998.1 | FxLYD domain-containing protein | - |
| ABVR74_RS07875 (ABVR74_07875) | - | 1589111..1589416 (-) | 306 | WP_278216411.1 | hypothetical protein | - |
| ABVR74_RS07880 (ABVR74_07880) | - | 1589482..1590063 (-) | 582 | WP_353891600.1 | major tail protein | - |
| ABVR74_RS07885 (ABVR74_07885) | - | 1590078..1590467 (-) | 390 | WP_353891601.1 | hypothetical protein | - |
| ABVR74_RS07890 (ABVR74_07890) | - | 1590464..1590868 (-) | 405 | WP_353891602.1 | HK97 gp10 family phage protein | - |
| ABVR74_RS07895 (ABVR74_07895) | - | 1590861..1591247 (-) | 387 | WP_353891603.1 | phage head-tail adapter protein | - |
| ABVR74_RS07900 (ABVR74_07900) | - | 1591213..1591545 (-) | 333 | WP_058210171.1 | hypothetical protein | - |
| ABVR74_RS07905 (ABVR74_07905) | - | 1591563..1591820 (-) | 258 | WP_353891604.1 | hypothetical protein | - |
| ABVR74_RS07910 (ABVR74_07910) | - | 1591881..1593014 (-) | 1134 | WP_353891605.1 | phage major capsid protein | - |
| ABVR74_RS07915 (ABVR74_07915) | - | 1593014..1593799 (-) | 786 | WP_353891606.1 | head maturation protease, ClpP-related | - |
| ABVR74_RS07920 (ABVR74_07920) | - | 1593786..1594979 (-) | 1194 | WP_353891607.1 | hypothetical protein | - |
| ABVR74_RS07925 (ABVR74_07925) | - | 1595171..1596910 (-) | 1740 | WP_353891608.1 | terminase large subunit | - |
| ABVR74_RS07930 (ABVR74_07930) | - | 1596907..1597500 (-) | 594 | WP_353891609.1 | helix-turn-helix transcriptional regulator | - |
| ABVR74_RS07935 (ABVR74_07935) | - | 1597642..1597941 (-) | 300 | WP_039116107.1 | HNH endonuclease | - |
| ABVR74_RS07940 (ABVR74_07940) | - | 1597990..1598289 (-) | 300 | WP_039116109.1 | hypothetical protein | - |
| ABVR74_RS07945 (ABVR74_07945) | - | 1598483..1599280 (-) | 798 | WP_353891610.1 | hypothetical protein | - |
| ABVR74_RS07950 (ABVR74_07950) | - | 1599284..1599835 (-) | 552 | WP_353891611.1 | LemA family protein | - |
| ABVR74_RS07955 (ABVR74_07955) | - | 1599953..1600345 (-) | 393 | WP_353891612.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABVR74_RS07960 (ABVR74_07960) | - | 1600470..1601531 (-) | 1062 | WP_064973650.1 | DNA methyltransferase | - |
| ABVR74_RS07965 (ABVR74_07965) | - | 1601747..1602382 (-) | 636 | WP_353891613.1 | hypothetical protein | - |
| ABVR74_RS07970 (ABVR74_07970) | - | 1602330..1602692 (-) | 363 | WP_353891614.1 | hypothetical protein | - |
| ABVR74_RS07975 (ABVR74_07975) | - | 1602820..1603074 (-) | 255 | WP_259683574.1 | DUF1031 family protein | - |
| ABVR74_RS07980 (ABVR74_07980) | - | 1603289..1603681 (-) | 393 | WP_353891615.1 | hypothetical protein | - |
| ABVR74_RS07985 (ABVR74_07985) | - | 1603685..1604524 (-) | 840 | WP_353891616.1 | DnaD domain protein | - |
| ABVR74_RS07990 (ABVR74_07990) | ssb | 1604535..1604969 (-) | 435 | WP_353891617.1 | single-stranded DNA-binding protein | Machinery gene |
| ABVR74_RS07995 (ABVR74_07995) | - | 1604959..1605180 (-) | 222 | WP_353891618.1 | hypothetical protein | - |
| ABVR74_RS08000 (ABVR74_08000) | - | 1605177..1605341 (-) | 165 | WP_336271810.1 | hypothetical protein | - |
| ABVR74_RS08005 (ABVR74_08005) | - | 1605429..1605680 (-) | 252 | WP_033900176.1 | hypothetical protein | - |
| ABVR74_RS08010 (ABVR74_08010) | - | 1605820..1606536 (-) | 717 | WP_353891619.1 | ORF6C domain-containing protein | - |
| ABVR74_RS08015 (ABVR74_08015) | - | 1606551..1606781 (-) | 231 | WP_353891620.1 | helix-turn-helix transcriptional regulator | - |
| ABVR74_RS08020 (ABVR74_08020) | - | 1606951..1607487 (+) | 537 | WP_353891621.1 | helix-turn-helix domain-containing protein | - |
| ABVR74_RS08025 (ABVR74_08025) | - | 1607498..1608085 (+) | 588 | WP_353891622.1 | hypothetical protein | - |
| ABVR74_RS08030 (ABVR74_08030) | - | 1608143..1608862 (+) | 720 | WP_353891623.1 | hypothetical protein | - |
| ABVR74_RS08035 (ABVR74_08035) | - | 1608992..1610122 (+) | 1131 | WP_313791723.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 16245.94 Da Isoelectric Point: 4.9268
>NTDB_id=1013833 ABVR74_RS07990 WP_353891617.1 1604535..1604969(-) (ssb) [Lactococcus lactis subsp. lactis strain CBA3648]
MINNVVIVGRITRDPELRYTPQQNQAVTTFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGTLIGLTGKIQT
RNYENQQGQRVYITEVAADSFQMLESKGGAKQNEESQNNTAPNFARDNSHDIPGTEISDDDLPF
MINNVVIVGRITRDPELRYTPQQNQAVTTFSLAVNRQFKNANGEREADFINCVIWRQQAENLANWAKKGTLIGLTGKIQT
RNYENQQGQRVYITEVAADSFQMLESKGGAKQNEESQNNTAPNFARDNSHDIPGTEISDDDLPF
Nucleotide
Download Length: 435 bp
>NTDB_id=1013833 ABVR74_RS07990 WP_353891617.1 1604535..1604969(-) (ssb) [Lactococcus lactis subsp. lactis strain CBA3648]
ATGATAAATAACGTTGTAATAGTTGGACGTATTACACGAGATCCAGAATTAAGATATACACCACAACAAAATCAGGCAGT
TACAACTTTCAGTTTGGCTGTTAATCGCCAATTTAAGAACGCAAATGGAGAACGTGAGGCAGACTTCATAAATTGCGTTA
TCTGGCGTCAGCAAGCCGAAAATTTAGCAAATTGGGCTAAAAAAGGAACTTTGATTGGATTAACTGGTAAAATCCAAACA
CGAAACTATGAAAATCAGCAAGGGCAACGAGTTTACATCACAGAAGTAGCTGCTGACAGTTTCCAAATGCTGGAAAGCAA
AGGGGGAGCAAAACAAAATGAAGAGTCACAAAATAATACAGCTCCGAATTTTGCGCGTGACAATTCCCATGATATTCCAG
GTACAGAAATTAGCGATGATGATTTGCCATTTTAG
ATGATAAATAACGTTGTAATAGTTGGACGTATTACACGAGATCCAGAATTAAGATATACACCACAACAAAATCAGGCAGT
TACAACTTTCAGTTTGGCTGTTAATCGCCAATTTAAGAACGCAAATGGAGAACGTGAGGCAGACTTCATAAATTGCGTTA
TCTGGCGTCAGCAAGCCGAAAATTTAGCAAATTGGGCTAAAAAAGGAACTTTGATTGGATTAACTGGTAAAATCCAAACA
CGAAACTATGAAAATCAGCAAGGGCAACGAGTTTACATCACAGAAGTAGCTGCTGACAGTTTCCAAATGCTGGAAAGCAA
AGGGGGAGCAAAACAAAATGAAGAGTCACAAAATAATACAGCTCCGAATTTTGCGCGTGACAATTCCCATGATATTCCAG
GTACAGAAATTAGCGATGATGATTTGCCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.335 |
100 |
0.653 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.124 |
100 |
0.632 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.75 |
100 |
0.438 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.206 |
74.306 |
0.403 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.278 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.278 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.278 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.278 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.278 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.583 |
100 |
0.396 |
| ssbA | Streptococcus mutans UA159 |
38.889 |
100 |
0.389 |