Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | U1770_RS09910 | Genome accession | NZ_CP159430 |
| Coordinates | 2003256..2003684 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934783.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN40 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1968746..2024101 | 2003256..2003684 | within | 0 |
Gene organization within MGE regions
Location: 1968746..2024101
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U1770_RS09635 (U1770_09635) | scn | 1968746..1969096 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| U1770_RS09640 (U1770_09640) | - | 1969779..1970228 (+) | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| U1770_RS09645 (U1770_09645) | - | 1970323..1970657 (-) | 335 | Protein_1863 | SH3 domain-containing protein | - |
| U1770_RS09650 (U1770_09650) | sak | 1971308..1971799 (-) | 492 | WP_000920042.1 | staphylokinase | - |
| U1770_RS09655 (U1770_09655) | - | 1971990..1972745 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| U1770_RS09660 (U1770_09660) | - | 1972757..1973011 (-) | 255 | WP_000611512.1 | phage holin | - |
| U1770_RS09665 (U1770_09665) | - | 1973063..1973170 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| U1770_RS09670 (U1770_09670) | pepG1 | 1973223..1973357 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| U1770_RS09675 (U1770_09675) | - | 1973549..1973845 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| U1770_RS09680 (U1770_09680) | - | 1973903..1974190 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| U1770_RS09685 (U1770_09685) | - | 1974237..1974389 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| U1770_RS09690 (U1770_09690) | - | 1974379..1978164 (-) | 3786 | WP_031807577.1 | phage tail spike protein | - |
| U1770_RS09695 (U1770_09695) | - | 1978180..1979664 (-) | 1485 | WP_000567393.1 | phage tail domain-containing protein | - |
| U1770_RS09700 (U1770_09700) | - | 1979661..1984205 (-) | 4545 | WP_031807820.1 | phage tail tape measure protein | - |
| U1770_RS09705 (U1770_09705) | - | 1984262..1984399 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| U1770_RS09710 (U1770_09710) | - | 1984450..1984800 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| U1770_RS09715 (U1770_09715) | - | 1984850..1985080 (-) | 231 | Protein_1877 | Ig-like domain-containing protein | - |
| U1770_RS09720 (U1770_09720) | - | 1985116..1985760 (-) | 645 | WP_000268740.1 | major tail protein | - |
| U1770_RS09725 (U1770_09725) | - | 1985761..1986168 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| U1770_RS09730 (U1770_09730) | - | 1986165..1986569 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| U1770_RS09735 (U1770_09735) | - | 1986566..1986928 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| U1770_RS09740 (U1770_09740) | - | 1986912..1987196 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| U1770_RS09745 (U1770_09745) | - | 1987186..1987470 (-) | 285 | WP_058144562.1 | hypothetical protein | - |
| U1770_RS09750 (U1770_09750) | - | 1987490..1988635 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| U1770_RS09755 (U1770_09755) | - | 1988659..1989396 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| U1770_RS09760 (U1770_09760) | - | 1989380..1990567 (-) | 1188 | WP_058144560.1 | phage portal protein | - |
| U1770_RS09765 (U1770_09765) | - | 1990583..1992244 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| U1770_RS09770 (U1770_09770) | - | 1992241..1992585 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| U1770_RS09775 (U1770_09775) | - | 1992715..1993014 (-) | 300 | WP_000988330.1 | HNH endonuclease | - |
| U1770_RS09780 (U1770_09780) | - | 1993246..1993662 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| U1770_RS09785 (U1770_09785) | - | 1993690..1993890 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| U1770_RS09790 (U1770_09790) | - | 1993890..1994540 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| U1770_RS09795 (U1770_09795) | - | 1994699..1994848 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| U1770_RS09800 (U1770_09800) | - | 1994845..1995231 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| U1770_RS09805 (U1770_09805) | - | 1995228..1995434 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| U1770_RS09810 (U1770_09810) | - | 1995471..1996004 (-) | 534 | WP_031807824.1 | dUTPase | - |
| U1770_RS09815 (U1770_09815) | - | 1996019..1996180 (-) | 162 | WP_000889682.1 | hypothetical protein | - |
| U1770_RS09820 (U1770_09820) | - | 1996181..1996354 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| U1770_RS09825 (U1770_09825) | - | 1996344..1996595 (-) | 252 | WP_001065046.1 | DUF1024 family protein | - |
| U1770_RS09830 (U1770_09830) | - | 1996588..1996872 (-) | 285 | WP_031807825.1 | hypothetical protein | - |
| U1770_RS09835 (U1770_09835) | - | 1996869..1997306 (-) | 438 | WP_031807826.1 | YopX family protein | - |
| U1770_RS09840 (U1770_09840) | - | 1997303..1997497 (-) | 195 | WP_031794818.1 | hypothetical protein | - |
| U1770_RS09845 (U1770_09845) | - | 1997494..1997895 (-) | 402 | WP_031807827.1 | hypothetical protein | - |
| U1770_RS09850 (U1770_09850) | - | 1997910..1998158 (-) | 249 | WP_075339544.1 | phi PVL orf 51-like protein | - |
| U1770_RS09855 (U1770_09855) | - | 1998167..1998367 (-) | 201 | WP_000235326.1 | hypothetical protein | - |
| U1770_RS09860 (U1770_09860) | - | 1998370..1998627 (-) | 258 | WP_031807828.1 | DUF3310 domain-containing protein | - |
| U1770_RS09865 (U1770_09865) | - | 1998627..1998986 (-) | 360 | WP_031807829.1 | SA1788 family PVL leukocidin-associated protein | - |
| U1770_RS09870 (U1770_09870) | - | 1998987..1999172 (-) | 186 | WP_001187236.1 | DUF3113 family protein | - |
| U1770_RS09875 (U1770_09875) | - | 1999234..1999581 (-) | 348 | WP_049309264.1 | DUF1064 domain-containing protein | - |
| U1770_RS09880 (U1770_09880) | - | 1999592..1999813 (-) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| U1770_RS09885 (U1770_09885) | - | 1999826..1999987 (-) | 162 | WP_000237153.1 | hypothetical protein | - |
| U1770_RS09890 (U1770_09890) | - | 1999981..2000760 (-) | 780 | WP_322417485.1 | ATP-binding protein | - |
| U1770_RS09895 (U1770_09895) | - | 2000770..2001540 (-) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| U1770_RS09900 (U1770_09900) | - | 2001605..2002462 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| U1770_RS09905 (U1770_09905) | - | 2002568..2003242 (-) | 675 | WP_015977703.1 | putative HNHc nuclease | - |
| U1770_RS09910 (U1770_09910) | ssbA | 2003256..2003684 (-) | 429 | WP_000934783.1 | single-stranded DNA-binding protein | Machinery gene |
| U1770_RS09915 (U1770_09915) | - | 2003684..2004322 (-) | 639 | WP_001043071.1 | ERF family protein | - |
| U1770_RS09920 (U1770_09920) | - | 2004322..2004801 (-) | 480 | WP_000002516.1 | siphovirus Gp157 family protein | - |
| U1770_RS09925 (U1770_09925) | - | 2004816..2005076 (-) | 261 | WP_031807830.1 | DUF1108 family protein | - |
| U1770_RS09930 (U1770_09930) | - | 2005168..2005329 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| U1770_RS09935 (U1770_09935) | - | 2005326..2005646 (-) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| U1770_RS09940 (U1770_09940) | - | 2005796..2005894 (-) | 99 | Protein_1922 | hypothetical protein | - |
| U1770_RS09945 (U1770_09945) | - | 2005925..2006119 (-) | 195 | WP_000388066.1 | hypothetical protein | - |
| U1770_RS09950 (U1770_09950) | - | 2006136..2006888 (-) | 753 | WP_031807832.1 | phage antirepressor KilAC domain-containing protein | - |
| U1770_RS09955 (U1770_09955) | - | 2006939..2007268 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| U1770_RS09960 (U1770_09960) | - | 2007257..2007472 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| U1770_RS09965 (U1770_09965) | - | 2007488..2007751 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| U1770_RS09970 (U1770_09970) | - | 2007748..2007921 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| U1770_RS09975 (U1770_09975) | - | 2007884..2008597 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| U1770_RS09980 (U1770_09980) | - | 2008613..2009545 (+) | 933 | WP_058144558.1 | exonuclease domain-containing protein | - |
| U1770_RS09985 (U1770_09985) | - | 2009551..2009892 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| U1770_RS09990 (U1770_09990) | - | 2010096..2010278 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| U1770_RS09995 (U1770_09995) | - | 2010378..2010842 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| U1770_RS10000 (U1770_10000) | - | 2010901..2011938 (+) | 1038 | WP_000857185.1 | site-specific integrase | - |
| U1770_RS10005 (U1770_10005) | sph | 2011995..2012819 (+) | 825 | Protein_1935 | sphingomyelin phosphodiesterase | - |
| U1770_RS10010 (U1770_10010) | lukG | 2013057..2014073 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| U1770_RS10015 (U1770_10015) | lukH | 2014095..2015150 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| U1770_RS10020 (U1770_10020) | - | 2015586..2016809 (+) | 1224 | WP_058144556.1 | ArgE/DapE family deacylase | - |
| U1770_RS10025 (U1770_10025) | - | 2017253..2018560 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| U1770_RS10030 (U1770_10030) | groL | 2019100..2020716 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| U1770_RS10035 (U1770_10035) | groES | 2020792..2021076 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| U1770_RS10040 (U1770_10040) | mroQ | 2021251..2021994 (+) | 744 | WP_322417491.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| U1770_RS10045 (U1770_10045) | - | 2022019..2023278 (-) | 1260 | WP_000120297.1 | SdrH family protein | - |
| U1770_RS10050 (U1770_10050) | - | 2023475..2024101 (+) | 627 | WP_000522381.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16047.61 Da Isoelectric Point: 5.8724
>NTDB_id=1013532 U1770_RS09910 WP_000934783.1 2003256..2003684(-) (ssbA) [Staphylococcus aureus strain BSN40]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAIIDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1013532 U1770_RS09910 WP_000934783.1 2003256..2003684(-) (ssbA) [Staphylococcus aureus strain BSN40]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTATTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
80.986 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.099 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.099 |
0.373 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.099 |
0.373 |