Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABHF04_RS02365 | Genome accession | NZ_CP156997 |
| Coordinates | 461197..461622 (-) | Length | 141 a.a. |
| NCBI ID | WP_347921137.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain 13_7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 425008..483063 | 461197..461622 | within | 0 |
Gene organization within MGE regions
Location: 425008..483063
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABHF04_RS02125 (ABHF04_02125) | - | 425008..425781 (-) | 774 | WP_070366758.1 | alpha/beta hydrolase | - |
| ABHF04_RS02130 (ABHF04_02130) | ptsP | 425854..427578 (-) | 1725 | WP_008842201.1 | phosphoenolpyruvate--protein phosphotransferase | - |
| ABHF04_RS02135 (ABHF04_02135) | - | 427578..427844 (-) | 267 | WP_002829779.1 | phosphocarrier protein HPr | - |
| ABHF04_RS02140 (ABHF04_02140) | - | 427987..428175 (-) | 189 | WP_008842200.1 | hypothetical protein | - |
| ABHF04_RS02145 (ABHF04_02145) | - | 428391..430598 (+) | 2208 | WP_002829782.1 | ATP-dependent Clp protease ATP-binding subunit | - |
| ABHF04_RS02150 (ABHF04_02150) | - | 430927..431904 (-) | 978 | WP_159208851.1 | GMP reductase | - |
| ABHF04_RS02155 (ABHF04_02155) | - | 433029..434150 (-) | 1122 | WP_347921081.1 | peptidoglycan recognition family protein | - |
| ABHF04_RS02160 (ABHF04_02160) | - | 434134..434376 (-) | 243 | WP_347921083.1 | phage holin | - |
| ABHF04_RS02165 (ABHF04_02165) | - | 434376..434666 (-) | 291 | WP_347921085.1 | hypothetical protein | - |
| ABHF04_RS02170 (ABHF04_02170) | - | 434710..434856 (-) | 147 | WP_176582254.1 | XkdX family protein | - |
| ABHF04_RS02175 (ABHF04_02175) | - | 434856..435170 (-) | 315 | WP_347921087.1 | DUF2977 domain-containing protein | - |
| ABHF04_RS02180 (ABHF04_02180) | - | 435172..435933 (-) | 762 | WP_176582256.1 | hypothetical protein | - |
| ABHF04_RS02185 (ABHF04_02185) | - | 435952..437796 (-) | 1845 | WP_347921089.1 | BppU family phage baseplate upper protein | - |
| ABHF04_RS02190 (ABHF04_02190) | - | 437800..438246 (-) | 447 | WP_347921091.1 | hypothetical protein | - |
| ABHF04_RS02195 (ABHF04_02195) | - | 438230..441190 (-) | 2961 | WP_347921093.1 | phage tail protein | - |
| ABHF04_RS02200 (ABHF04_02200) | - | 441190..441954 (-) | 765 | WP_347921095.1 | phage tail protein | - |
| ABHF04_RS02205 (ABHF04_02205) | - | 441954..444974 (-) | 3021 | WP_347921097.1 | phage tail tape measure protein | - |
| ABHF04_RS02210 (ABHF04_02210) | - | 444958..445236 (-) | 279 | WP_347921099.1 | hypothetical protein | - |
| ABHF04_RS02215 (ABHF04_02215) | - | 445383..445724 (-) | 342 | WP_176582117.1 | tail assembly chaperone | - |
| ABHF04_RS02220 (ABHF04_02220) | - | 445797..446453 (-) | 657 | WP_070366318.1 | phage major tail protein, TP901-1 family | - |
| ABHF04_RS02225 (ABHF04_02225) | - | 446465..446848 (-) | 384 | WP_070366319.1 | hypothetical protein | - |
| ABHF04_RS02230 (ABHF04_02230) | - | 446873..447214 (-) | 342 | WP_347921101.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABHF04_RS02235 (ABHF04_02235) | - | 447207..447515 (-) | 309 | WP_241531648.1 | hypothetical protein | - |
| ABHF04_RS02240 (ABHF04_02240) | - | 447520..447885 (-) | 366 | WP_176582122.1 | phage head-tail connector protein | - |
| ABHF04_RS02245 (ABHF04_02245) | - | 447896..448162 (-) | 267 | WP_347921475.1 | Ig-like domain-containing protein | - |
| ABHF04_RS02250 (ABHF04_02250) | - | 448180..448998 (-) | 819 | WP_347921104.1 | N4-gp56 family major capsid protein | - |
| ABHF04_RS02255 (ABHF04_02255) | - | 448998..449714 (-) | 717 | WP_058121207.1 | DUF4355 domain-containing protein | - |
| ABHF04_RS02260 (ABHF04_02260) | - | 449829..450038 (-) | 210 | WP_195459779.1 | hypothetical protein | - |
| ABHF04_RS02265 (ABHF04_02265) | - | 450050..451015 (-) | 966 | WP_347921106.1 | minor capsid protein | - |
| ABHF04_RS02270 (ABHF04_02270) | - | 450999..452279 (-) | 1281 | WP_347921478.1 | phage portal protein | - |
| ABHF04_RS02275 (ABHF04_02275) | - | 452400..453746 (-) | 1347 | WP_347921108.1 | PBSX family phage terminase large subunit | - |
| ABHF04_RS02280 (ABHF04_02280) | - | 453739..454230 (-) | 492 | WP_347921110.1 | terminase small subunit | - |
| ABHF04_RS02285 (ABHF04_02285) | - | 454422..454655 (-) | 234 | WP_347921112.1 | hypothetical protein | - |
| ABHF04_RS02290 (ABHF04_02290) | - | 455117..455533 (-) | 417 | WP_347921114.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ABHF04_RS02295 (ABHF04_02295) | - | 455715..455879 (-) | 165 | WP_347921115.1 | hypothetical protein | - |
| ABHF04_RS02300 (ABHF04_02300) | - | 455876..456076 (-) | 201 | WP_347921117.1 | hypothetical protein | - |
| ABHF04_RS02305 (ABHF04_02305) | - | 456080..456373 (-) | 294 | WP_347921119.1 | hypothetical protein | - |
| ABHF04_RS02310 (ABHF04_02310) | - | 456374..456631 (-) | 258 | WP_347921121.1 | hypothetical protein | - |
| ABHF04_RS02315 (ABHF04_02315) | - | 456631..456924 (-) | 294 | WP_347921122.1 | hypothetical protein | - |
| ABHF04_RS02320 (ABHF04_02320) | - | 456908..457087 (-) | 180 | WP_347921124.1 | hypothetical protein | - |
| ABHF04_RS02325 (ABHF04_02325) | - | 457090..457461 (-) | 372 | WP_347921126.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ABHF04_RS02330 (ABHF04_02330) | - | 457448..457597 (-) | 150 | WP_317059631.1 | hypothetical protein | - |
| ABHF04_RS02335 (ABHF04_02335) | - | 457594..457995 (-) | 402 | WP_204229941.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABHF04_RS02340 (ABHF04_02340) | - | 457976..458608 (-) | 633 | WP_347921129.1 | RNA polymerase subunit sigma-70 | - |
| ABHF04_RS02345 (ABHF04_02345) | - | 458726..459541 (-) | 816 | WP_347921131.1 | ATP-binding protein | - |
| ABHF04_RS02350 (ABHF04_02350) | - | 459522..460265 (-) | 744 | WP_347921133.1 | hypothetical protein | - |
| ABHF04_RS02355 (ABHF04_02355) | - | 460295..460519 (-) | 225 | WP_347921135.1 | hypothetical protein | - |
| ABHF04_RS02360 (ABHF04_02360) | - | 460509..461186 (-) | 678 | WP_347921136.1 | putative HNHc nuclease | - |
| ABHF04_RS02365 (ABHF04_02365) | ssb | 461197..461622 (-) | 426 | WP_347921137.1 | single-stranded DNA-binding protein | Machinery gene |
| ABHF04_RS02370 (ABHF04_02370) | - | 461615..461821 (-) | 207 | WP_024863113.1 | hypothetical protein | - |
| ABHF04_RS02375 (ABHF04_02375) | - | 461814..462539 (-) | 726 | WP_138492715.1 | ERF family protein | - |
| ABHF04_RS02380 (ABHF04_02380) | - | 462540..462998 (-) | 459 | WP_235015673.1 | chromosome segregation protein SMC | - |
| ABHF04_RS02385 (ABHF04_02385) | - | 463236..463574 (-) | 339 | WP_098040706.1 | DUF771 domain-containing protein | - |
| ABHF04_RS02390 (ABHF04_02390) | - | 463592..463777 (-) | 186 | WP_347921139.1 | hypothetical protein | - |
| ABHF04_RS02395 (ABHF04_02395) | - | 463780..464514 (-) | 735 | WP_347921141.1 | Rha family transcriptional regulator | - |
| ABHF04_RS02400 (ABHF04_02400) | - | 464528..464737 (-) | 210 | WP_065124225.1 | helix-turn-helix transcriptional regulator | - |
| ABHF04_RS02405 (ABHF04_02405) | - | 464995..465336 (+) | 342 | WP_098040704.1 | helix-turn-helix transcriptional regulator | - |
| ABHF04_RS02410 (ABHF04_02410) | - | 465345..465791 (+) | 447 | WP_235015672.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABHF04_RS02415 (ABHF04_02415) | - | 465848..466278 (+) | 431 | Protein_454 | PH domain-containing protein | - |
| ABHF04_RS02420 (ABHF04_02420) | - | 466313..466711 (+) | 399 | WP_098040702.1 | hypothetical protein | - |
| ABHF04_RS02425 (ABHF04_02425) | - | 466780..467670 (+) | 891 | WP_347921143.1 | DUF5067 domain-containing protein | - |
| ABHF04_RS02430 (ABHF04_02430) | - | 467776..467907 (+) | 132 | WP_255031768.1 | hypothetical protein | - |
| ABHF04_RS02435 (ABHF04_02435) | - | 467897..468448 (-) | 552 | WP_098040700.1 | hypothetical protein | - |
| ABHF04_RS02440 (ABHF04_02440) | - | 468623..469759 (+) | 1137 | WP_347921146.1 | site-specific integrase | - |
| ABHF04_RS02450 (ABHF04_02450) | - | 470165..470419 (-) | 255 | WP_002829785.1 | helix-turn-helix domain-containing protein | - |
| ABHF04_RS02455 (ABHF04_02455) | - | 470703..470939 (-) | 237 | WP_002829787.1 | hypothetical protein | - |
| ABHF04_RS02460 (ABHF04_02460) | - | 470951..471982 (-) | 1032 | WP_004166567.1 | LCP family protein | - |
| ABHF04_RS02465 (ABHF04_02465) | - | 472076..473392 (-) | 1317 | WP_087115682.1 | DEAD/DEAH box helicase | - |
| ABHF04_RS02470 (ABHF04_02470) | - | 473399..474406 (-) | 1008 | WP_347921149.1 | Gfo/Idh/MocA family oxidoreductase | - |
| ABHF04_RS02475 (ABHF04_02475) | - | 474718..475098 (+) | 381 | WP_002829792.1 | DUF4828 domain-containing protein | - |
| ABHF04_RS02480 (ABHF04_02480) | - | 475139..475906 (-) | 768 | WP_087115685.1 | GH25 family lysozyme | - |
| ABHF04_RS02485 (ABHF04_02485) | - | 476025..477347 (+) | 1323 | WP_002829794.1 | amino acid permease | - |
| ABHF04_RS02490 (ABHF04_02490) | - | 477381..477908 (+) | 528 | WP_005917432.1 | VanZ family protein | - |
| ABHF04_RS02495 (ABHF04_02495) | - | 478105..480030 (-) | 1926 | WP_087115687.1 | copper-translocating P-type ATPase | - |
| ABHF04_RS02500 (ABHF04_02500) | - | 480030..480302 (-) | 273 | WP_159208852.1 | cupredoxin domain-containing protein | - |
| ABHF04_RS02505 (ABHF04_02505) | - | 480321..480695 (-) | 375 | WP_159208853.1 | cupredoxin domain-containing protein | - |
| ABHF04_RS02510 (ABHF04_02510) | - | 480696..481151 (-) | 456 | WP_159208854.1 | CopY/TcrY family copper transport repressor | - |
| ABHF04_RS02515 (ABHF04_02515) | - | 481304..482215 (+) | 912 | WP_159208855.1 | exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | - |
| ABHF04_RS02520 (ABHF04_02520) | - | 482215..483063 (+) | 849 | WP_347921153.1 | DNA/RNA non-specific endonuclease | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15582.30 Da Isoelectric Point: 8.0068
>NTDB_id=1003788 ABHF04_RS02365 WP_347921137.1 461197..461622(-) (ssb) [Pediococcus acidilactici strain 13_7]
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFANFTRKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDSLPF
MINRTVLIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFANFTRKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDSLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1003788 ABHF04_RS02365 WP_347921137.1 461197..461622(-) (ssb) [Pediococcus acidilactici strain 13_7]
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTTATCAACTGCGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCCAACTTCACGCGTAAAGGTTCTCTAGTAGGCATTGAAGGGCGGATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCGGGAGATCCGTTCGCTAATGGCGGACAATCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
ATGATTAATCGAACAGTACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTTATCAACTGCGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCCAACTTCACGCGTAAAGGTTCTCTAGTAGGCATTGAAGGGCGGATTCAAACCCGT
TCGTACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCGAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCGGGAGATCCGTTCGCTAATGGCGGACAATCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.412 |
100 |
0.716 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.667 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.185 |
76.596 |
0.461 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.404 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.404 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.404 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.404 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.141 |
100 |
0.404 |
| ssbA | Streptococcus mutans UA159 |
36.62 |
100 |
0.369 |