Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2446307..2446501 | Replicon | chromosome |
Accession | NZ_CP008816 | ||
Organism | Enterococcus faecalis ATCC 29212 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | DR75_RS16295 | Protein ID | WP_015543884.1 |
Coordinates | 2446406..2446501 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2446307..2446371 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DR75_RS12785 (DR75_2397) | 2441931..2443679 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
DR75_RS12790 (DR75_2398) | 2443670..2445703 | + | 2034 | WP_002355275.1 | transcription antiterminator | - |
DR75_RS12795 (DR75_2399) | 2445714..2446148 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 2446307..2446371 | + | 65 | - | - | Antitoxin |
DR75_RS16295 | 2446406..2446501 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DR75_RS12805 (DR75_2400) | 2446747..2448231 | + | 1485 | WP_200880684.1 | PTS mannitol transporter subunit IICB | - |
DR75_RS16415 | 2448285..2448518 | + | 234 | WP_200880685.1 | hypothetical protein | - |
DR75_RS12810 (DR75_2402) | 2448533..2448970 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
DR75_RS12815 (DR75_2403) | 2448985..2450139 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2450268..2451071 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T47618 WP_015543884.1 NZ_CP008816:c2446501-2446406 [Enterococcus faecalis ATCC 29212]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T47618 NZ_CP008816:c2446501-2446406 [Enterococcus faecalis ATCC 29212]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT47618 NZ_CP008816:2446307-2446371 [Enterococcus faecalis ATCC 29212]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|