Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 1097332..1097526 | Replicon | chromosome |
Accession | NZ_CP064374 | ||
Organism | Enterococcus faecalis strain PartL-Efaecalis-RM8376 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | IUJ47_RS05365 | Protein ID | WP_142954371.1 |
Coordinates | 1097431..1097526 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 1097332..1097396 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IUJ47_RS05350 | 1092956..1094704 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
IUJ47_RS05355 | 1094695..1096728 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
IUJ47_RS05360 | 1096739..1097173 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 1097332..1097396 | + | 65 | - | - | Antitoxin |
IUJ47_RS05365 | 1097431..1097526 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
IUJ47_RS05370 | 1097772..1099544 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
IUJ47_RS05375 | 1099559..1099996 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
IUJ47_RS05380 | 1100011..1101165 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1101294..1102097 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T181001 WP_142954371.1 NZ_CP064374:c1097526-1097431 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T181001 NZ_CP085797:c3537539-3537384 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 65 bp
>AT181001 NZ_CP064374:1097332-1097396 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|