Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 321386..321580 | Replicon | chromosome |
Accession | NZ_CP124923 | ||
Organism | Enterococcus faecalis strain EfsC11 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ48_RS01635 | Protein ID | WP_015543884.1 |
Coordinates | 321485..321580 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 321386..321450 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ48_RS01620 (317010) | 317010..318758 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
QLQ48_RS01625 (318749) | 318749..320782 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
QLQ48_RS01630 (320793) | 320793..321227 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- (321386) | 321386..321450 | + | 65 | NuclAT_14 | - | Antitoxin |
QLQ48_RS01635 (321485) | 321485..321580 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ48_RS01640 (321826) | 321826..323598 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ48_RS01645 (323613) | 323613..324050 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ48_RS01650 (324065) | 324065..325219 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 325348..326151 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281826 WP_015543884.1 NZ_CP124923:c321580-321485 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT281826 NZ_CP124923:321386-321450 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|