Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2879120..2879314 | Replicon | chromosome |
Accession | NZ_CP046111 | ||
Organism | Enterococcus faecalis strain 111540047-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | GKQ56_RS13955 | Protein ID | WP_015543884.1 |
Coordinates | 2879120..2879215 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2879250..2879314 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GKQ56_RS13940 | 2875481..2876635 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
GKQ56_RS13945 | 2876650..2877087 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
GKQ56_RS13950 | 2877102..2878874 | - | 1773 | WP_002387897.1 | PTS mannitol transporter subunit IICBA | - |
GKQ56_RS13955 | 2879120..2879215 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2879250..2879314 | - | 65 | NuclAT_14 | - | Antitoxin |
GKQ56_RS13960 | 2879473..2879907 | - | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
GKQ56_RS13965 | 2879918..2881951 | - | 2034 | WP_002355275.1 | transcription antiterminator | - |
GKQ56_RS13970 | 2881942..2883690 | - | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2874549..2875352 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T143572 WP_015543884.1 NZ_CP046111:2879120-2879215 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T143572 NZ_CP061206:2314212-2314319 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 65 bp
>AT143572 NZ_CP046111:c2879314-2879250 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|