Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 349462..349656 | Replicon | chromosome |
Accession | NZ_CP091231 | ||
Organism | Enterococcus faecalis strain 732 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | LQ055_RS01840 | Protein ID | WP_142954371.1 |
Coordinates | 349561..349656 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 349462..349526 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ055_RS01825 | 345086..346834 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
LQ055_RS01830 | 346825..348858 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
LQ055_RS01835 | 348869..349303 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 349462..349526 | + | 65 | - | - | Antitoxin |
LQ055_RS01840 | 349561..349656 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
LQ055_RS01845 | 349902..351674 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
LQ055_RS01850 | 351689..352126 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
LQ055_RS01855 | 352141..353295 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 353424..354227 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T232956 WP_142954371.1 NZ_CP091231:c349656-349561 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T232956 NZ_CP128501:c1624459-1624343 [Bacillus amyloliquefaciens]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 65 bp
>AT232956 NZ_CP091231:349462-349526 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|