Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 312301..312495 | Replicon | chromosome |
| Accession | NZ_CP110074 | ||
| Organism | Enterococcus faecalis strain BE5 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLM06_RS01565 | Protein ID | WP_142954371.1 |
| Coordinates | 312400..312495 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 312301..312365 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLM06_RS01550 | 307925..309673 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
| OLM06_RS01555 | 309664..311697 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
| OLM06_RS01560 | 311708..312142 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
| - | 312301..312365 | + | 65 | - | - | Antitoxin |
| OLM06_RS01565 | 312400..312495 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| OLM06_RS01570 | 312741..314513 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
| OLM06_RS01575 | 314528..314965 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| OLM06_RS01580 | 314980..316134 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 316263..317066 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T263055 WP_142954371.1 NZ_CP110074:c312495-312400 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT263055 NZ_CP110074:312301-312365 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|