Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 311255..311449 | Replicon | chromosome |
| Accession | NZ_CP128464 | ||
| Organism | Enterococcus faecalis strain RE25 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | QSV41_RS01915 | Protein ID | WP_142954371.1 |
| Coordinates | 311354..311449 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 311255..311319 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSV41_RS01900 | 306879..308627 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
| QSV41_RS01905 | 308618..310651 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
| QSV41_RS01910 | 310662..311096 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
| - | 311255..311319 | + | 65 | - | - | Antitoxin |
| QSV41_RS01915 | 311354..311449 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| QSV41_RS01920 | 311695..313467 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
| QSV41_RS01925 | 313482..313919 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| QSV41_RS01930 | 313934..315088 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 315217..316020 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T284583 WP_142954371.1 NZ_CP128464:c311449-311354 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT284583 NZ_CP128464:311255-311319 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|