Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2207429..2207623 | Replicon | chromosome |
Accession | NZ_CP014949 | ||
Organism | Enterococcus faecalis strain LD33 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | A3777_RS14665 | Protein ID | WP_142954371.1 |
Coordinates | 2207528..2207623 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2207429..2207493 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A3777_RS10920 | 2203053..2204801 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
A3777_RS10925 | 2204792..2206825 | + | 2034 | WP_002355275.1 | transcription antiterminator | - |
A3777_RS10930 | 2206836..2207270 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 2207429..2207493 | + | 65 | - | - | Antitoxin |
A3777_RS14665 | 2207528..2207623 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
A3777_RS10940 | 2207869..2209641 | + | 1773 | WP_002387897.1 | PTS mannitol transporter subunit IICBA | - |
A3777_RS10945 | 2209656..2210093 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
A3777_RS10950 | 2210108..2211262 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2211391..2212194 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T61943 WP_142954371.1 NZ_CP014949:c2207623-2207528 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T61943 NZ_CP014949:c2207623-2207528 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAGTTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAGTTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT61943 NZ_CP014949:2207429-2207493 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|