Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 352978..353172 | Replicon | chromosome |
Accession | NZ_CP116571 | ||
Organism | Enterococcus faecalis strain K190-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PML73_RS01870 | Protein ID | WP_142954371.1 |
Coordinates | 353077..353172 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 352978..353042 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML73_RS01855 | 348602..350350 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
PML73_RS01860 | 350341..352374 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
PML73_RS01865 | 352385..352819 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 352978..353042 | + | 65 | - | - | Antitoxin |
PML73_RS01870 | 353077..353172 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PML73_RS01875 | 353418..355190 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
PML73_RS01880 | 355205..355642 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PML73_RS01885 | 355657..356811 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 356940..357743 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T268999 WP_142954371.1 NZ_CP116571:c353172-353077 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT268999 NZ_CP116571:352978-353042 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|