Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 308444..308638 | Replicon | chromosome |
| Accession | NZ_CP110053 | ||
| Organism | Enterococcus faecalis strain BE25 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | OLL87_RS01560 | Protein ID | WP_015543884.1 |
| Coordinates | 308543..308638 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 308444..308508 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL87_RS01545 (304062) | 304062..305804 | + | 1743 | WP_172352004.1 | PTS transporter subunit EIIC | - |
| OLL87_RS01550 (305795) | 305795..307828 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
| OLL87_RS01555 (307839) | 307839..308273 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
| - (308444) | 308444..308508 | + | 65 | NuclAT_10 | - | Antitoxin |
| OLL87_RS01560 (308543) | 308543..308638 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| OLL87_RS01565 (308884) | 308884..310656 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
| OLL87_RS01570 (310671) | 310671..311108 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| OLL87_RS01575 (311123) | 311123..312277 | + | 1155 | WP_083578772.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 312995..313798 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T262897 WP_015543884.1 NZ_CP110053:c308638-308543 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT262897 NZ_CP110053:308444-308508 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|