Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 312341..312535 | Replicon | chromosome |
Accession | NZ_CP118962 | ||
Organism | Enterococcus faecalis strain DSM 20478 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PYW42_RS01560 | Protein ID | WP_142954371.1 |
Coordinates | 312440..312535 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 312341..312405 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW42_RS01545 | 307965..309713 | + | 1749 | WP_002403688.1 | PTS transporter subunit EIIC | - |
PYW42_RS01550 | 309704..311737 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
PYW42_RS01555 | 311748..312182 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 312341..312405 | + | 65 | - | - | Antitoxin |
PYW42_RS01560 | 312440..312535 | - | 96 | WP_142954371.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PYW42_RS01565 | 312781..314553 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
PYW42_RS01570 | 314568..315005 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PYW42_RS01575 | 315020..316174 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 316303..317106 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.6275
>T273641 WP_142954371.1 NZ_CP118962:c312535-312440 [Enterococcus faecalis]
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKVLVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT273641 NZ_CP118962:312341-312405 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|