Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4316930..4317729 | Replicon | chromosome |
Accession | NZ_CP103739 | ||
Organism | Escherichia coli strain 3359 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | M5T33_RS21275 | Protein ID | WP_000347273.1 |
Coordinates | 4316930..4317394 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M5T33_RS21280 | Protein ID | WP_001307405.1 |
Coordinates | 4317394..4317729 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T33_RS21245 (4312359) | 4312359..4313348 | - | 990 | WP_000548347.1 | bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB | - |
M5T33_RS21250 (4313447) | 4313447..4314385 | - | 939 | WP_000104211.1 | transcriptional regulator TdcA | - |
M5T33_RS21255 (4314700) | 4314700..4314918 | + | 219 | WP_001301311.1 | transcriptional activator TdcR | - |
M5T33_RS21260 (4315174) | 4315174..4315713 | + | 540 | WP_000675733.1 | protein YhaB | - |
M5T33_RS21265 (4315735) | 4315735..4316097 | + | 363 | Protein_4146 | hypothetical protein | - |
M5T33_RS21275 (4316930) | 4316930..4317394 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5T33_RS21280 (4317394) | 4317394..4317729 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5T33_RS21285 (4317878) | 4317878..4319449 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
M5T33_RS21290 (4319824) | 4319824..4321158 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5T33_RS21295 (4321174) | 4321174..4321944 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4315174..4326493 | 11319 | ||
- | flank | IS/Tn | - | - | 4316114..4316491 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T256441 WP_000347273.1 NZ_CP103739:c4317394-4316930 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |