Detailed information of regulator


Summary

Regulator ID REG0253 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS00612 insolico (Type i4a); T6SS00613 insolico (Type i1); T6SS00611 insolico (Type i3)
Strain Pseudomonas aeruginosa M18
Replicon chromosome
Sequence Protein sequence (215 a.a.); Nucleotide sequence (645 bp)
Description The β-galactosidase activities resulting from gacA mutant and wild-type strain M18 showed T6SS was downregulated in the gacA mutant compared with their expression in M18.
Reference

External database links

Locus tag (Gene) PAM18_RS12360 (gacA)
Coordinates (Strand) 2625815..2626459 (+)
NCBI ID 489180874
RefSeq NC_017548
Uniprot ID V6AEI3_PSEAI, A0A1C7BRH9_PSEAI, A0A0H2ZC55_PSEAB, GACA_PSEAE, A6V4J1_PSEA7
KEGG ID pap:PSPA7_2613, pae:PA2586, pau:PA14_30650
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
hsiA1 operon transcript -
hsiA2 operon transcript -
hsiA3 operon transcript -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 2.8e-28 4..116
GerE PF00196.21 1.2e-14 148..204

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-214 VIKVLVVDDHDLVRTGITRMLADIEGLQVVGQADCGEDCLKLARELKPDVVLMDVKMPGIGGLEATRKLLRSQPDIKVVVVTVCEEDPFPTRLMQAGAAGYMTKGAGLEEMVQAIRQVFAGQRYISPQIAQQLALKSFQPQQHDSPFDSLSEREIQIALMIANCHKVQSISDKLCLSPKTVNTYRYRIFEKLSITSDVELALLAVRHGMVDAAS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9941 - -



  Protein sequence of regulator: 215 a.a.    .

>REG0253 NC_017548:2625815-2626459 [Pseudomonas aeruginosa M18]
VIKVLVVDDHDLVRTGITRMLADIEGLQVVGQADCGEDCLKLARELKPDVVLMDVKMPGIGGLEATRKLLRSQPDIKVVV
VTVCEEDPFPTRLMQAGAAGYMTKGAGLEEMVQAIRQVFAGQRYISPQIAQQLALKSFQPQQHDSPFDSLSEREIQIALM
IANCHKVQSISDKLCLSPKTVNTYRYRIFEKLSITSDVELALLAVRHGMVDAAS*

  Nucleotide sequence of regulator: 645 bp    .

>REG0253 NC_017548:2625815-2626459 [Pseudomonas aeruginosa M18]
GTGATTAAGGTGCTGGTGGTCGACGACCACGATCTGGTACGCACCGGTATTACCCGCATGCTGGCCGACATCGAAGGCTT
GCAAGTGGTCGGCCAGGCCGACTGCGGTGAAGACTGTCTGAAACTGGCCCGCGAACTGAAGCCGGATGTCGTCCTGATGG
ACGTGAAGATGCCCGGTATCGGCGGCCTGGAGGCAACCCGCAAGCTGCTGCGCAGCCAGCCCGACATCAAGGTCGTGGTA
GTCACCGTCTGCGAAGAGGATCCGTTCCCCACCCGCCTCATGCAGGCCGGCGCCGCCGGCTACATGACCAAGGGCGCGGG
GCTGGAGGAAATGGTCCAGGCGATTCGCCAGGTCTTCGCCGGCCAGCGCTATATCAGCCCGCAGATCGCCCAGCAACTGG
CGCTGAAGTCCTTCCAGCCGCAGCAGCACGATTCCCCCTTCGATTCGCTGTCCGAGCGCGAGATCCAGATCGCCCTGATG
ATCGCCAACTGCCACAAGGTGCAGAGCATCTCCGACAAGCTGTGCCTGTCGCCGAAGACCGTGAATACCTATCGCTACCG
CATCTTCGAGAAGCTCTCGATCACCAGCGACGTGGAGCTGGCGCTGCTCGCCGTCCGCCACGGCATGGTCGATGCCGCCA
GCTAG