Detailed information of regulator


Summary

Regulator ID REG0170 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00150 experimental (Type i3); T6SS00152 experimental (Type i1); T6SS00151 experimental (Type i4a)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (109 a.a.); Nucleotide sequence (327 bp)
Description AmrZ binds to all three assessed T6SS promoter regions and activates expression of H1-T6SS (tssA1).; AmrZ binds to all three assessed T6SS promoter regions and represses H2-T6SS(tssB2) transcription and H2-T6SS bacterial Killing.; AmrZ binds to all three assessed T6SS promoter regions and activates expression of H3-T6SS(vgrG3).
Reference

External database links

Locus tag (Gene) PA14_20290 (AmrZ)
Coordinates (Strand) 1747602..1747928 (-)
NCBI ID 489182353
RefSeq NC_008463
Uniprot ID V6AC97_PSEAI, A0A1C7BYS8_PSEAI, A0A0H2ZEB1_PSEAB, AMRZ_PSEAE
KEGG ID pae:PA3385, pau:PA14_20290
KEGG pathway (determined by BlastKOALA) -
PDB ID 3QOQ

  Target
Target Regulation (↓/↑) Target sequence
TssA1 (PA14_00990) promotor tcttttaaagatttgtccgatctgcggtgtcatgcaactagtggcgttgtgccttccttgacaagccttgcggcatgccacaagaattttgccaacctttcgagtcatccgatattcatcaatggctcctacaagatccgacggagtggatcttacaagcgaaggtgag
TssA2 (PA14_43050) promotor ccctctttgggaattttcctattcattgatacgaatcaatgaaagattttcagccaaacgtcaggcgtctgcgtccatgccctttacggcttggctatagccatcataacgacattgatggccatttggaaaaccctaccaaaacaggtagttaacaatttataaaaaataaggcagacaacagtggattcc
TssB3 (PA14_34070) promotor cctctggtccgtcactggcgacgaactacaaaagacgctagaacaggtctatggatttgcaaaataaaattttcgttggactcccatgaagcacggatgtttcaccatatgtcggaaattctccctggcgctggcgatcctggcgctggccggctgctcgtatttcttcgcgccgcgggtcgagttgcagcggctgaccctggatgtcgccgcgcgcgccaacgacgactcgccgatcgccgtggacttcgtcgcggtgaaggatgcggagctgttcaaggagctggccggactgccggccagccagtggttcgccaatcgcgagcagtaccgccgcgactaccggcagcagttcgcggtatggagcctggagctggtcccggggcagttcatcgagtcg

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Arc PF03869.16 1.7e-28 13..62

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-108 MRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDNLGVRLDSPELSLHERELLQRFRQLTHRQQNALVALIAHDAELAQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9886 - -



  Protein sequence of regulator: 109 a.a.    .

>REG0170 NC_008463:c1747928-1747602 [Pseudomonas aeruginosa UCBPP-PA14]
MRPLKQATPTYSSRTADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDNLGVRLDSPELSLHEREL
LQRFRQLTHRQQNALVALIAHDAELAQA*

  Nucleotide sequence of regulator: 327 bp    .

>REG0170 NC_008463:c1747928-1747602 [Pseudomonas aeruginosa UCBPP-PA14]
ATGCGCCCACTGAAACAGGCAACTCCTACCTACTCCAGCCGTACCGCTGACAAATTCGTCGTTCGTCTGCCCGAGGGCAT
GCGTGAGCAGATCGCAGAAGTCGCTCGCAGCCATCACCGCAGCATGAACTCCGAGATCATCGCCCGACTCGAGCAGAGCC
TGCTCCAGGAAGGGGCGCTGCAAGACAATCTCGGTGTTCGCCTGGACAGCCCGGAACTCAGCCTGCACGAGCGCGAGCTG
CTGCAGCGTTTCCGCCAGCTGACCCACCGTCAGCAGAACGCGCTGGTCGCCCTGATCGCACACGATGCGGAGCTGGCCCA
GGCCTGA