Detailed information of regulator


Summary

Regulator ID REG0169 experimental
Regulator type protein
Regulatory pathway (from literatures) Global regulator
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS00150 experimental (Type i3); T6SS00152 experimental (Type i1); T6SS00151 experimental (Type i4a)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (310 a.a.); Nucleotide sequence (930 bp)
Description PA3225 directly interacts with the tssABC1 promoter,and planktonic expression of tssA1 is decreased 2-fold in the absence of PA3225.; RsmA binds the tssA1 mRNA in a region overlapping the ribosome binding site (RBS), which is thought to form a stem–loop structure.; RsmA binds the tssA2 mRNA in a region overlapping the ribosome binding site (RBS), and contains the core GGA motif.; RsmA binds the tssB3 mRNA in a region overlapping the ribosome binding site (RBS),and contains the core GGA motif.
Reference

External database links

Locus tag (Gene) PA14_22470 (PA3225)
Coordinates (Strand) 1955624..1956553 (-)
NCBI ID 489182081
RefSeq NC_008463
Uniprot ID V6ABP6_PSEAI, A0A0H2ZDR5_PSEAB, Q9HZ15_PSEAE
KEGG ID pae:PA3225, pau:PA14_22470
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
PA14_00990 (TssA) promotor -
TssA1 (PA14_00990) transcript auagggagaucgucaccgug Predicted RsmA binding sites.Putative RsmA binding site is indicated by blue and red, precdited RBS is indicated by red.
TssA2 (PA14_43050) transcript gaaggguuaggaugaccuau Putative RsmA binding site is indicated by blue and red, precdited RBS is indicated by red.
TssB3 (PA14_34070) transcript caucggagucagccgccaug Putative RsmA binding site is indicated by blue and red, precdited RBS is indicated by red.

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
LysR_substrate PF03466.22 2.9e-26 92..291
HTH_1 PF00126.29 8.3e-19 8..67

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-309 MKAPRVTLDQWRTLQAVVDHGGFAQAAEALHRSQSSISYTVARMQEQLGVPLLRIDGRKAVLTEAGEVLLRRSRQLVKQAGQLEELAHHMEQGWEPEVRLVVDAAYPTARIVRSLSAFMPQSRGCRVLLREEVLSGVEEALIQGAADLAISGLIIPGHLGADLSVVEFVAVAHPDHPLHRLQRELTHQDLETQMQVVIRDSGRLQPRDHGWLGAEQRWTVGSLATAATFVGNGLGFAWLPRHIIERELQSGQLKPLPLSQGGVRQSRFYLYTNKEKPLGPASQILMEMLKSFANVPLNAPFAAPEPAAE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9804 - -



  Protein sequence of regulator: 310 a.a.    .

>REG0169 NC_008463:c1956553-1955624 [Pseudomonas aeruginosa UCBPP-PA14]
MKAPRVTLDQWRTLQAVVDHGGFAQAAEALHRSQSSISYTVARMQEQLGVPLLRIDGRKAVLTEAGEVLLRRSRQLVKQA
GQLEELAHHMEQGWEPEVRLVVDAAYPTARIVRSLSAFMPQSRGCRVLLREEVLSGVEEALIQGAADLAISGLIIPGHLG
ADLSVVEFVAVAHPDHPLHRLQRELTHQDLETQMQVVIRDSGRLQPRDHGWLGAEQRWTVGSLATAATFVGNGLGFAWLP
RHIIERELQSGQLKPLPLSQGGVRQSRFYLYTNKEKPLGPASQILMEMLKSFANVPLNAPFAAPEPAAE*

  Nucleotide sequence of regulator: 930 bp    .

>REG0169 NC_008463:c1956553-1955624 [Pseudomonas aeruginosa UCBPP-PA14]
ATGAAAGCGCCACGCGTAACCCTGGACCAATGGCGGACCCTGCAGGCGGTGGTCGACCACGGCGGCTTCGCCCAGGCCGC
GGAAGCCCTGCACCGCTCGCAATCGTCGATCAGCTATACCGTGGCGCGCATGCAGGAACAGCTCGGCGTGCCGCTGCTGC
GCATCGACGGACGCAAGGCGGTGCTGACCGAGGCCGGCGAAGTGCTGCTGCGCCGCTCGCGGCAACTGGTCAAGCAGGCC
GGGCAACTGGAGGAACTGGCCCACCACATGGAACAGGGCTGGGAGCCCGAGGTGCGTCTGGTGGTGGACGCCGCCTACCC
CACCGCGCGGATCGTCCGCTCGCTGTCCGCCTTCATGCCGCAGAGCCGCGGCTGTCGCGTGCTGCTGCGCGAGGAAGTGC
TCTCCGGCGTCGAGGAAGCGCTGATCCAGGGCGCCGCCGACCTGGCGATCAGCGGCCTGATCATTCCCGGCCACCTCGGC
GCCGACCTCAGCGTGGTCGAGTTCGTCGCCGTGGCCCACCCCGACCATCCGCTGCACCGCCTGCAACGCGAGCTGACCCA
CCAGGACCTGGAAACCCAGATGCAGGTGGTGATCCGCGACAGCGGCCGGCTACAGCCGCGCGACCACGGCTGGCTCGGCG
CCGAACAGCGCTGGACGGTGGGCAGCCTGGCTACCGCGGCGACCTTCGTCGGCAACGGCCTGGGCTTCGCCTGGCTGCCG
CGACACATCATCGAGCGCGAACTGCAGAGCGGCCAACTCAAGCCGCTGCCGCTGAGCCAGGGCGGCGTGCGGCAGAGCCG
CTTCTACCTCTACACCAACAAGGAGAAGCCGCTCGGCCCGGCCAGCCAGATCCTCATGGAAATGCTCAAGTCGTTCGCCA
ACGTACCGCTCAACGCGCCCTTCGCGGCGCCCGAACCGGCCGCCGAGTGA