Detailed information of effector


Summary

Effector ID EFF76654 experimental
Effector type -
Cognate immunity protein IMU38225 experimental; IMU38226 experimental
Related T6SS (Type) T6SS00164 experimental (Type i3)
Strain Acidovorax citrulli AAC00-1
Replicon chromosome
Sequence Protein sequence (1605 a.a.); Nucleotide sequence (4815 bp)
Description Deletion of rhsB significantly impairs the ability of killing Bacillus subtilis while ectopic expression of immunity proteins RimB1 or RimB2 confers protection.
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AAVE_RS02475 (RhsB)
Coordinates (Strand) 538874..543688 (+)
NCBI ID WP_011793679.1
RefSeq NC_008752
Uniprot ID UPI0000DCC179
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 4.1e-22 261..336
RHS PF03527.16 1.5e-15 1360..1396
PAAR_motif PF05488.15 8.9e-13 92..160
RHS_repeat PF05593.16 2.4e-07 714..750
RHS_repeat PF05593.16 4.9e-06 798..834
RHS_repeat PF05593.16 3e-05 576..608

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-20 MPKAARLHDPIAHTYAREGH
Transmembrane helix 21-43 AAGAATAVALEFGTAVAIGAAVG
Outside 44-52 SIACPGLGT
Transmembrane helix 53-75 LAGIAIGIGVALVSFAIAHVASL
Inside 76-197 YGDFAQSFGEAFGRSFTSDCGELKATGSSTVFINGKPAIRTGLDVAECDKHKMPPSLVIYGSENVFIDSYRAAREGDRVDCEAKISKGSEDVFIGGESVPIAEFRVNEVPESDREFARKARF
Transmembrane helix 198-220 WAGILGGGVSALKAGVKCFGMAV
Outside 221-1604 LTGVVGAKVMGEIMPSFDGGHSAATALGDGMGTAVGNLLQGKPVHVVTGAKVLLGDDDTDFSLPGALPIVWRRTYASCDARTGALGTGWSLPFSVELVFEGGKAHFIDEAGRDIPFDDLPPGGQMFSVPEGVQLSRGEGGAYFIGMPALGWIYCFGQRAGSSDGERLGLQQWADFNGNTIDFHRDADGVVRHVTDSAGHRLALRYAQAGGLRLVRVDLTAGGPAGTLVEYRYDTRGQLAQVIDRLGRCVRRFTWEGATLVAQTFASGLVARYRWDGPAPQGRVVQHWLEDAAPGMPATAWTFEYDLPGERPGDRRTRVTDHLGRVQLFDHDADQNVTRIEDPLGQVQRMEWNDLWQLLAWTRADGSRFTFTYDRLGNLNGATDPLGQTARLDWHERLQRVRAATAVDGTRWHYTYDDRGNRTEVLGPPLKPGTPPHIPSDGDEVRWRESTLHDPRGLPVVTIDANGGRQQWTWDERALLVRHTDCSGKTTRFEYDGNGFLSKHIDALGQITHYVHDALGRLLSVTRADGTAERYTYDGADQLVSAGDSSNRLTHYRYDIHGKLLALQRPDGSTVHLGYDAAHRLASLVSENGANYRFAYDTANRLVQEQRPDGSRHTFSHDSLGRVVELREDPGEDDVVGQAIRGHAPAAPIRTTCERDGIGRLIAKRVQAMTGAPSSQDTIEQRFAYDKMNRLVRAETLDAAGQSPAQVAEFGYTLLGDLAQEAAEDVVSGTRSVMRHTCDPLGNRLATELPDGRLLRELHYGSGHVHQISLDGVVVADIERDDLHREVLRTQGRWASRWAYDPLGRQRAQWTQSASLRVGGNWAQQMPDAANASGPGMLTDGLRKQWDYDAAGELVRTRHSRNGETQYRYDPAGHVLSATLQAAGAAGGLSPALQQALHEVFHYDPAGNRLDAPVPQGAEGSRGWVRHNRVKVLQDKRFDYDGFGRLVRKRIGGHTELHCRYDALHRMIAASVIRAGRDGEPIRQVFRYRYDPLGRRIAKEDDFGETRFVWEGMRLLQESRGAHNSTYLYEPSSYRPLARIDGTGPLEPEHPVAVLALAGEDPRGDPAAGKVRSIPVTNGDASDARHAVAGPVGATARYLAEVEALERGAGPDEPGQSTGRGGQARQTQSASTPSARIYYFHLQPSGLPEEMSDRNGHLVWRAQYRLWGNAVAEEWQAFDATGRPVNAPMAETGIRAQVSASPAPQNLRMQGQYLDRETGLHYNTFRYYDPDLGAFTTPDPIGLAGGLNLHGYAANPLSWIDPWGWACIPNKVAGTAREARVGAKLDGKFGASNVLRERYLRDANGKIVRDPLTGEARRVDFVVKGSDGKGTAIEVTSKTANKDAQQLKEARIRAQGGVYVREPGSKVLVEVRNTSRVVRVE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8765 - -



  Protein sequence: 1605 a.a.    .

>EFF76654 NC_008752:538874-543688 [Acidovorax citrulli AAC00-1]
MPKAARLHDPIAHTYAREGHAAGAATAVALEFGTAVAIGAAVGSIACPGLGTLAGIAIGIGVALVSFAIAHVASLYGDFA
QSFGEAFGRSFTSDCGELKATGSSTVFINGKPAIRTGLDVAECDKHKMPPSLVIYGSENVFIDSYRAAREGDRVDCEAKI
SKGSEDVFIGGESVPIAEFRVNEVPESDREFARKARFWAGILGGGVSALKAGVKCFGMAVLTGVVGAKVMGEIMPSFDGG
HSAATALGDGMGTAVGNLLQGKPVHVVTGAKVLLGDDDTDFSLPGALPIVWRRTYASCDARTGALGTGWSLPFSVELVFE
GGKAHFIDEAGRDIPFDDLPPGGQMFSVPEGVQLSRGEGGAYFIGMPALGWIYCFGQRAGSSDGERLGLQQWADFNGNTI
DFHRDADGVVRHVTDSAGHRLALRYAQAGGLRLVRVDLTAGGPAGTLVEYRYDTRGQLAQVIDRLGRCVRRFTWEGATLV
AQTFASGLVARYRWDGPAPQGRVVQHWLEDAAPGMPATAWTFEYDLPGERPGDRRTRVTDHLGRVQLFDHDADQNVTRIE
DPLGQVQRMEWNDLWQLLAWTRADGSRFTFTYDRLGNLNGATDPLGQTARLDWHERLQRVRAATAVDGTRWHYTYDDRGN
RTEVLGPPLKPGTPPHIPSDGDEVRWRESTLHDPRGLPVVTIDANGGRQQWTWDERALLVRHTDCSGKTTRFEYDGNGFL
SKHIDALGQITHYVHDALGRLLSVTRADGTAERYTYDGADQLVSAGDSSNRLTHYRYDIHGKLLALQRPDGSTVHLGYDA
AHRLASLVSENGANYRFAYDTANRLVQEQRPDGSRHTFSHDSLGRVVELREDPGEDDVVGQAIRGHAPAAPIRTTCERDG
IGRLIAKRVQAMTGAPSSQDTIEQRFAYDKMNRLVRAETLDAAGQSPAQVAEFGYTLLGDLAQEAAEDVVSGTRSVMRHT
CDPLGNRLATELPDGRLLRELHYGSGHVHQISLDGVVVADIERDDLHREVLRTQGRWASRWAYDPLGRQRAQWTQSASLR
VGGNWAQQMPDAANASGPGMLTDGLRKQWDYDAAGELVRTRHSRNGETQYRYDPAGHVLSATLQAAGAAGGLSPALQQAL
HEVFHYDPAGNRLDAPVPQGAEGSRGWVRHNRVKVLQDKRFDYDGFGRLVRKRIGGHTELHCRYDALHRMIAASVIRAGR
DGEPIRQVFRYRYDPLGRRIAKEDDFGETRFVWEGMRLLQESRGAHNSTYLYEPSSYRPLARIDGTGPLEPEHPVAVLAL
AGEDPRGDPAAGKVRSIPVTNGDASDARHAVAGPVGATARYLAEVEALERGAGPDEPGQSTGRGGQARQTQSASTPSARI
YYFHLQPSGLPEEMSDRNGHLVWRAQYRLWGNAVAEEWQAFDATGRPVNAPMAETGIRAQVSASPAPQNLRMQGQYLDRE
TGLHYNTFRYYDPDLGAFTTPDPIGLAGGLNLHGYAANPLSWIDPWGWACIPNKVAGTAREARVGAKLDGKFGASNVLRE
RYLRDANGKIVRDPLTGEARRVDFVVKGSDGKGTAIEVTSKTANKDAQQLKEARIRAQGGVYVREPGSKVLVEVRNTSRV
VRVE*

  Nucleotide sequence: 4815 bp    .

>EFF76654 NC_008752:538874-543688 [Acidovorax citrulli AAC00-1]
ATGCCCAAGGCCGCCCGACTGCACGATCCGATCGCCCATACCTATGCACGCGAAGGGCATGCGGCGGGGGCCGCCACAGC
GGTCGCGCTCGAGTTCGGCACGGCCGTCGCTATCGGGGCCGCGGTCGGATCAATCGCGTGCCCGGGTCTCGGCACGCTCG
CGGGCATCGCCATCGGCATCGGCGTTGCGCTGGTTTCGTTCGCCATCGCGCACGTCGCGAGTCTTTATGGTGATTTCGCG
CAATCCTTTGGCGAGGCCTTCGGGCGAAGTTTCACTTCTGATTGTGGCGAGCTCAAGGCGACCGGATCGAGCACGGTCTT
CATCAACGGCAAGCCAGCGATTCGCACGGGCCTGGATGTGGCCGAGTGCGACAAGCACAAGATGCCGCCCAGTCTGGTGA
TCTACGGCAGCGAGAACGTCTTCATCGACAGCTACCGCGCCGCTCGCGAAGGCGACCGTGTGGACTGCGAGGCCAAAATC
AGCAAGGGCTCGGAGGATGTCTTCATCGGTGGCGAGTCCGTGCCCATCGCGGAGTTCCGCGTGAACGAAGTACCGGAGTC
CGACCGCGAGTTCGCCAGAAAGGCCCGCTTTTGGGCAGGCATTCTCGGCGGCGGCGTCAGCGCACTGAAGGCTGGCGTCA
AGTGTTTCGGGATGGCCGTGCTCACCGGCGTGGTGGGTGCGAAGGTGATGGGAGAGATCATGCCGTCGTTCGATGGCGGG
CACTCCGCGGCAACGGCCTTGGGCGACGGGATGGGCACGGCCGTCGGCAATCTCCTGCAAGGCAAGCCGGTACACGTGGT
GACCGGCGCCAAGGTGCTGCTGGGTGACGACGACACCGACTTCAGCCTGCCCGGGGCACTGCCCATCGTCTGGCGCCGCA
CTTATGCGTCCTGCGATGCGCGCACGGGCGCGCTGGGCACTGGCTGGAGCCTGCCTTTCAGCGTGGAACTGGTCTTCGAG
GGCGGCAAGGCGCACTTCATCGATGAGGCCGGCCGCGACATCCCCTTCGACGACCTGCCGCCCGGCGGCCAGATGTTCAG
CGTGCCGGAAGGCGTGCAACTGAGCCGCGGGGAGGGCGGCGCCTACTTCATCGGCATGCCTGCGCTGGGCTGGATCTACT
GCTTCGGCCAGCGCGCCGGCAGCAGCGATGGCGAACGCCTCGGGTTGCAGCAATGGGCGGATTTCAACGGCAACACCATC
GACTTCCATCGCGATGCCGATGGCGTGGTGCGGCATGTGACCGACAGCGCAGGCCACCGGCTCGCGCTGCGCTATGCGCA
GGCCGGCGGGCTGCGCCTCGTGCGCGTGGACCTCACGGCGGGCGGCCCGGCCGGCACGCTGGTCGAATACCGCTACGACA
CCCGCGGCCAGCTTGCCCAGGTCATCGACCGCCTGGGCCGCTGCGTGCGGCGCTTCACCTGGGAGGGGGCCACCCTCGTC
GCGCAAACCTTCGCGAGCGGGCTGGTGGCCCGCTACCGGTGGGACGGGCCCGCGCCCCAAGGCCGCGTGGTGCAGCACTG
GCTGGAGGATGCGGCCCCGGGCATGCCCGCCACCGCCTGGACCTTCGAATACGACCTGCCCGGCGAACGGCCCGGCGATC
GGCGCACGCGCGTCACGGACCACCTCGGAAGGGTGCAACTCTTCGACCACGATGCGGACCAGAACGTCACGCGCATCGAG
GATCCGCTGGGGCAGGTGCAGCGCATGGAGTGGAACGACCTGTGGCAACTGCTGGCCTGGACGCGCGCGGACGGCAGCCG
GTTCACCTTCACCTATGACCGCCTGGGCAACCTGAACGGCGCCACCGACCCGTTGGGGCAGACCGCCCGGCTGGACTGGC
ACGAACGCCTGCAGCGCGTGCGCGCGGCCACCGCCGTGGACGGAACCCGCTGGCACTACACCTATGACGACCGCGGCAAC
CGCACGGAAGTGCTGGGGCCGCCGCTGAAGCCTGGTACGCCGCCGCATATTCCAAGTGATGGGGACGAGGTTCGCTGGCG
TGAATCCACGCTGCACGATCCCCGTGGCCTGCCGGTGGTCACCATCGACGCGAACGGTGGACGCCAGCAATGGACCTGGG
ATGAACGCGCCCTGCTGGTGCGCCACACCGACTGCTCGGGCAAGACCACGCGCTTCGAGTACGACGGCAATGGGTTCTTG
AGCAAGCACATCGATGCGCTGGGGCAGATCACCCACTACGTGCATGATGCGTTGGGACGCCTGTTGAGCGTGACGCGGGC
GGACGGAACAGCGGAACGATACACCTACGACGGCGCAGACCAGCTAGTTTCGGCGGGCGATTCGAGCAACCGGCTCACGC
ACTACCGCTATGACATCCACGGCAAGCTGCTGGCACTGCAACGCCCCGACGGCAGCACGGTCCACCTGGGCTATGACGCA
GCGCACCGCCTCGCAAGCCTCGTCAGCGAGAACGGTGCCAACTACCGCTTTGCCTACGACACCGCCAACCGGCTGGTCCA
GGAACAGCGGCCGGACGGTAGCCGTCACACCTTCTCTCACGATTCGCTGGGACGAGTGGTGGAACTGCGGGAAGACCCCG
GCGAGGACGACGTCGTTGGGCAGGCAATCCGGGGGCATGCGCCGGCAGCGCCGATCCGCACCACCTGCGAGCGTGACGGC
ATCGGGCGGCTGATCGCGAAGCGCGTGCAGGCCATGACGGGGGCACCGTCTTCGCAAGACACCATCGAGCAGCGCTTCGC
CTACGACAAGATGAACCGGCTGGTGCGCGCGGAGACGCTCGATGCTGCGGGACAGTCGCCCGCGCAAGTGGCGGAATTCG
GCTACACCCTGCTGGGGGATCTGGCGCAGGAAGCAGCGGAGGACGTTGTATCCGGCACCCGCAGCGTGATGCGCCACACC
TGCGACCCGTTGGGCAATCGCCTTGCCACCGAACTACCGGATGGGCGCTTGCTGCGCGAATTGCATTACGGCAGCGGCCA
TGTCCACCAGATCAGTTTGGACGGCGTGGTGGTGGCCGACATCGAGCGCGACGATCTGCACCGCGAGGTGCTGCGCACGC
AGGGTCGCTGGGCGAGCCGCTGGGCCTACGACCCGCTGGGCCGGCAACGGGCACAGTGGACCCAATCAGCGAGCCTGCGT
GTCGGGGGCAACTGGGCACAACAGATGCCGGACGCGGCGAACGCGTCTGGACCGGGCATGCTAACGGATGGCCTGCGCAA
GCAATGGGACTATGACGCTGCGGGTGAGCTGGTGCGCACGCGCCACAGCCGAAATGGGGAGACCCAGTACCGCTATGACC
CCGCTGGCCATGTCCTATCGGCTACGCTGCAGGCTGCCGGGGCCGCAGGCGGTCTTTCTCCGGCGTTGCAACAGGCGCTG
CACGAAGTGTTTCATTACGATCCCGCCGGCAATCGGCTGGACGCGCCCGTGCCTCAAGGCGCAGAAGGTAGCCGGGGCTG
GGTGCGCCACAACCGAGTGAAGGTGCTGCAGGACAAGCGCTTCGACTACGACGGCTTCGGCCGGCTGGTGCGCAAGCGCA
TCGGCGGGCACACCGAACTGCACTGCCGTTACGACGCGCTACACCGCATGATCGCCGCGTCGGTGATCCGTGCGGGCCGC
GACGGAGAGCCGATCCGGCAGGTCTTCCGCTACCGTTACGACCCGCTCGGCCGGCGCATCGCCAAGGAGGACGACTTCGG
CGAGACGCGATTCGTATGGGAGGGCATGCGGCTTCTGCAGGAGAGCCGCGGCGCGCACAACAGCACCTACCTGTACGAGC
CGTCCAGCTACCGGCCGCTGGCGCGTATCGACGGTACCGGTCCGCTGGAGCCGGAGCATCCAGTTGCAGTGCTGGCGCTC
GCAGGGGAAGACCCGCGAGGCGACCCGGCCGCGGGCAAGGTCCGTTCGATTCCGGTCACCAATGGTGACGCCAGTGATGC
GCGCCATGCTGTGGCTGGACCCGTGGGGGCGACCGCACGCTATCTGGCTGAGGTGGAAGCCCTCGAGCGCGGCGCTGGGC
CAGATGAGCCCGGCCAGTCCACAGGGCGGGGCGGGCAGGCACGGCAGACCCAGAGTGCATCCACTCCTTCCGCGCGGATT
TACTACTTCCACCTACAACCCAGCGGGTTGCCCGAGGAGATGAGCGATCGCAATGGGCACCTCGTGTGGCGGGCTCAATA
CCGCTTGTGGGGCAATGCGGTCGCTGAGGAGTGGCAGGCCTTCGATGCAACGGGCCGACCGGTGAACGCTCCGATGGCGG
AGACGGGCATCCGGGCGCAAGTCAGCGCGTCACCCGCTCCCCAAAACCTGCGTATGCAGGGGCAGTACCTGGACCGGGAA
ACGGGGTTGCATTACAACACCTTCCGGTACTACGACCCGGACCTTGGTGCCTTCACCACGCCGGATCCAATCGGTTTGGC
TGGCGGTCTGAACCTGCATGGGTATGCAGCAAACCCCCTGTCCTGGATCGATCCCTGGGGCTGGGCCTGCATCCCGAACA
AGGTGGCAGGCACCGCACGCGAAGCGCGCGTAGGTGCTAAATTGGACGGTAAGTTCGGCGCGTCAAATGTCTTGCGTGAA
CGATATCTTCGCGATGCAAACGGGAAGATTGTTCGCGACCCTTTGACGGGGGAAGCGCGGCGTGTCGACTTTGTCGTAAA
GGGTTCCGATGGCAAGGGCACAGCGATTGAGGTCACGAGTAAAACCGCTAATAAGGATGCGCAGCAGCTGAAGGAGGCGC
GAATTAGAGCCCAAGGCGGAGTTTATGTGCGTGAGCCAGGATCAAAGGTGCTGGTTGAAGTGCGCAATACATCTAGAGTT
GTAAGAGTGGAGTGA