Detailed information of immunity protein


Summary

Immunity protein ID IMU38225 experimental
Cognate effector EFF76654 experimental
Related T6SS (Type) T6SS00164 experimental (Type i3)
Strain Acidovorax citrulli AAC00-1
Replicon chromosome
Sequence Protein sequence (108 a.a.); Nucleotide sequence (324 bp)
Description Deletion of rhsB significantly impairs the ability of killing Bacillus subtilis while ectopic expression of immunity proteins RimB1 or RimB2 confers protection.
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AAVE_RS02480 (RimB1)
Coordinates (Strand) 543696..544019 (+)
NCBI ID WP_041827204.1
RefSeq NC_008752
Uniprot ID UPI00059F58E6
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-107 MQDFLVSPSLLDLYQATKSREWRAQVKAKITVIFKFLQDNNLANVRLLDESGEAIEDLVLMRSHLTEAGVKMFAKAIPAWQRARDKDGNLANIKLLEDGLKKILENG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9959 - -



  Protein sequence: 108 a.a.    .

>IMU38225 NC_008752:543696-544019 [Acidovorax citrulli AAC00-1]
MQDFLVSPSLLDLYQATKSREWRAQVKAKITVIFKFLQDNNLANVRLLDESGEAIEDLVLMRSHLTEAGVKMFAKAIPAW
QRARDKDGNLANIKLLEDGLKKILENG*

  Nucleotide sequence: 324 bp    .

>IMU38225 NC_008752:543696-544019 [Acidovorax citrulli AAC00-1]
ATGCAGGATTTTTTGGTATCCCCGAGTCTGTTGGATTTGTATCAGGCCACCAAGAGTAGGGAGTGGCGCGCACAGGTAAA
AGCTAAAATCACCGTTATATTTAAGTTTCTGCAGGACAATAATCTCGCCAATGTGAGGCTTCTTGATGAGTCGGGCGAGG
CGATTGAAGATCTGGTGCTGATGCGGTCACATCTCACAGAGGCAGGGGTGAAAATGTTTGCAAAGGCAATTCCTGCGTGG
CAGCGCGCACGCGATAAGGATGGGAATCTGGCGAACATCAAGTTGCTTGAGGATGGCCTGAAGAAGATATTGGAAAACGG
CTGA