Detailed information of effector


Summary

Effector ID EFF01886 experimental
Effector type Tse
Cognate immunity protein IMU00366 experimental; IMU00367 experimental
Related T6SS (Type) T6SS00907 experimental (Type iii)
Strain Bacteroides fragilis NCTC 9343
Replicon chromosome
Sequence Protein sequence (998 a.a.); Nucleotide sequence (2994 bp)
Description In- frame deletion of the candidate E/I pairs from the wild-type strain, and constitutive expression of the candidate immunity genes in a tssC recipient strain lacking both E/I pairs, confirmed that each immunity protein confers protection against T6S-mediated cell killing in an effector-specific manner.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BF9343_1928 (bte2)
Coordinates (Strand) 2353982..2356975 (-)
NCBI ID 60492933
RefSeq NC_003228
Uniprot ID Q5LDU6_BACFN
KEGG ID bfs:BF9343_1928
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-672 MKDDMIAIFGLKASGKGKEAQGNNLYAVDYVRLYLSLYGVYSKSTHKSGILAPLEGNDVSSFPAPKGFPDMKYGYSYQRIPLRKGYIYAYFEKHNTAGIFKEYEVTNEGGIVNLVWSDMENPRISWETPKKDRMTNYIVLRKQYDKKVWLVFSPIRWSKQYAEKVLGNEEERNKRMQSLECETCFKGEYDNHGFAVEEAKSILVSPPWDYLTEFSDKVKAGNYLEWENASYKAYFDRYKGQYEKNCALKKGDADNHDFYFSLFDPQGIADILCADIAIETRNLLVMVESMKTGDITKAYKKVDANALDGNYDNPELVALIDMGILLYRMSDVKTGVFTKYKSHISTDLLKTILLVEPRAKLRQKIHYIRELLSEIIMCEAYQLSIQDYLVEKMPTVNKGKSSLSKHLSGLANAPEKIDGYLDQPIGHSKNLSVTEKKIGNCINNVLSSESNTGKLLRKEWNLDEIVDSVSLITDTQDSVGDIADALLGYIRYIRANQKLNFISEVFRFVTKDGQIFVKIPEGMFTAELKNKIDFSHLRTTTLKGKGKGFLIKLSDVTDVDGNPISGSLSKFKRTNSSVSVSLDKLMPEWQKQLAKADNKGEKWAKGFKKFVDNPQFTRAMIGITILKTSLTVKKEDKNIEDSLELIGSVLFLADLKQEYLARLAPALMKKIG
Transmembrane helix 673-695 RTLSITTVVALNAASTVDGIYLI
Inside 696-701 KENQTA
Transmembrane helix 702-724 AGTIAIISGVSGGVGGVAIILGF
Outside 725-997 SNPYTIALIILSLSSTIILEAIRDTSLQSLLKNCAYGNNYKLNAKSGIELLNKALKTEVRSDKLKSFLYEQQKTLNQLLYIEQHAIRTELTLYYSYKTINSYPHTIHESTELNYLEITIRIWCMPLLDGEIEVYLYDIDGSDSNPPVESLFSETNIVQIDALQGVAVVRFEVEDPVNNTRKFRGGTLKIMVRIKNSEGQYLPTINGIPHGIASYFPYQNSFKTIVTEIKAGGQTRYNKKHKEIIKYDKLYTSPPADREELEIMEQKTKNNERS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9671 - -



  Protein sequence: 998 a.a.    .

>EFF01886 NC_003228:c2356975-2353982 [Bacteroides fragilis NCTC 9343]
MKDDMIAIFGLKASGKGKEAQGNNLYAVDYVRLYLSLYGVYSKSTHKSGILAPLEGNDVSSFPAPKGFPDMKYGYSYQRI
PLRKGYIYAYFEKHNTAGIFKEYEVTNEGGIVNLVWSDMENPRISWETPKKDRMTNYIVLRKQYDKKVWLVFSPIRWSKQ
YAEKVLGNEEERNKRMQSLECETCFKGEYDNHGFAVEEAKSILVSPPWDYLTEFSDKVKAGNYLEWENASYKAYFDRYKG
QYEKNCALKKGDADNHDFYFSLFDPQGIADILCADIAIETRNLLVMVESMKTGDITKAYKKVDANALDGNYDNPELVALI
DMGILLYRMSDVKTGVFTKYKSHISTDLLKTILLVEPRAKLRQKIHYIRELLSEIIMCEAYQLSIQDYLVEKMPTVNKGK
SSLSKHLSGLANAPEKIDGYLDQPIGHSKNLSVTEKKIGNCINNVLSSESNTGKLLRKEWNLDEIVDSVSLITDTQDSVG
DIADALLGYIRYIRANQKLNFISEVFRFVTKDGQIFVKIPEGMFTAELKNKIDFSHLRTTTLKGKGKGFLIKLSDVTDVD
GNPISGSLSKFKRTNSSVSVSLDKLMPEWQKQLAKADNKGEKWAKGFKKFVDNPQFTRAMIGITILKTSLTVKKEDKNIE
DSLELIGSVLFLADLKQEYLARLAPALMKKIGRTLSITTVVALNAASTVDGIYLIKENQTAAGTIAIISGVSGGVGGVAI
ILGFSNPYTIALIILSLSSTIILEAIRDTSLQSLLKNCAYGNNYKLNAKSGIELLNKALKTEVRSDKLKSFLYEQQKTLN
QLLYIEQHAIRTELTLYYSYKTINSYPHTIHESTELNYLEITIRIWCMPLLDGEIEVYLYDIDGSDSNPPVESLFSETNI
VQIDALQGVAVVRFEVEDPVNNTRKFRGGTLKIMVRIKNSEGQYLPTINGIPHGIASYFPYQNSFKTIVTEIKAGGQTRY
NKKHKEIIKYDKLYTSPPADREELEIMEQKTKNNERS*

  Nucleotide sequence: 2994 bp    .

>EFF01886 NC_003228:c2356975-2353982 [Bacteroides fragilis NCTC 9343]
ATGAAAGATGACATGATTGCTATATTTGGCTTAAAAGCATCTGGCAAAGGCAAGGAAGCACAAGGAAATAATCTATATGC
CGTGGATTATGTGAGACTCTATTTATCATTATATGGAGTCTACAGCAAAAGTACCCATAAAAGTGGGATATTGGCTCCTT
TAGAAGGTAATGATGTTAGTTCTTTTCCTGCTCCCAAAGGATTTCCCGATATGAAGTATGGATATTCATATCAGAGAATC
CCCTTACGGAAGGGATATATCTATGCTTATTTTGAGAAACATAACACGGCAGGAATCTTTAAAGAGTATGAAGTAACCAA
CGAGGGAGGAATAGTCAACTTGGTATGGTCCGATATGGAAAATCCTCGTATTTCATGGGAAACGCCCAAAAAAGACAGAA
TGACAAATTACATTGTCCTGCGAAAACAGTATGATAAAAAAGTTTGGCTGGTCTTTTCACCCATCAGATGGTCAAAACAG
TATGCAGAAAAGGTTTTGGGTAACGAGGAAGAAAGAAATAAGCGCATGCAATCACTGGAATGTGAAACTTGTTTTAAAGG
AGAATACGATAATCATGGCTTTGCTGTAGAAGAGGCCAAAAGTATATTGGTTAGCCCTCCGTGGGATTATCTTACTGAAT
TTTCTGACAAAGTGAAGGCCGGGAATTATTTGGAATGGGAAAATGCATCATATAAGGCATATTTTGACCGATATAAAGGA
CAATATGAGAAAAATTGCGCTCTAAAAAAGGGCGATGCAGACAATCATGATTTTTATTTCTCTTTGTTTGACCCACAGGG
AATAGCTGATATACTCTGCGCTGATATAGCCATAGAAACTCGAAATCTTCTGGTAATGGTAGAATCGATGAAGACCGGAG
ACATTACCAAAGCCTATAAAAAAGTGGATGCTAATGCTTTGGACGGAAACTATGACAATCCTGAGCTGGTGGCACTTATT
GATATGGGTATTTTGTTATACCGTATGTCGGATGTCAAAACTGGTGTTTTCACAAAATACAAATCACATATTTCTACAGA
TTTATTAAAGACAATACTTTTGGTCGAACCCCGTGCAAAGTTACGCCAGAAAATTCATTATATCCGTGAGTTACTTTCTG
AAATTATCATGTGCGAGGCTTACCAATTGTCAATACAAGATTACCTCGTTGAAAAAATGCCAACCGTTAACAAAGGAAAA
TCAAGTTTGTCGAAACACCTTAGCGGATTAGCAAATGCTCCTGAAAAAATTGATGGCTATTTGGACCAGCCTATTGGCCA
TTCTAAAAACCTATCAGTAACCGAAAAGAAGATTGGTAATTGTATAAACAATGTTTTGTCCAGTGAAAGTAATACTGGGA
AATTGCTCAGAAAAGAGTGGAACCTTGATGAAATAGTGGATAGTGTTTCTTTAATCACTGATACACAGGATTCTGTCGGT
GACATCGCAGATGCTCTGCTCGGTTATATTAGATATATCAGGGCTAATCAAAAGCTGAATTTCATATCTGAAGTTTTTCG
ATTTGTAACTAAGGATGGACAAATTTTTGTTAAAATTCCAGAAGGTATGTTTACTGCTGAATTAAAAAACAAGATAGATT
TTTCACACCTACGTACAACAACATTGAAAGGCAAAGGTAAAGGCTTTCTTATTAAACTCAGCGATGTGACGGATGTAGAT
GGTAATCCTATATCCGGTTCTTTGTCGAAATTCAAAAGGACTAATTCTTCTGTTTCCGTATCTTTGGATAAATTGATGCC
CGAATGGCAGAAGCAATTGGCCAAAGCTGACAATAAGGGTGAGAAGTGGGCAAAAGGATTTAAGAAGTTTGTTGATAATC
CTCAATTCACGAGAGCGATGATTGGCATCACCATTTTGAAAACTTCTCTTACCGTTAAAAAAGAAGATAAAAATATAGAA
GATTCTTTGGAACTTATCGGTAGTGTGCTTTTTCTTGCCGACTTGAAACAGGAATATCTTGCACGTCTTGCTCCGGCTTT
AATGAAAAAAATAGGGAGAACATTAAGTATTACAACTGTTGTTGCTCTAAATGCAGCCTCCACTGTTGACGGAATATATC
TTATTAAAGAAAATCAAACAGCGGCTGGTACTATAGCTATCATTTCAGGGGTATCCGGAGGTGTAGGTGGTGTGGCAATA
ATATTGGGCTTTTCCAATCCATACACAATAGCTTTAATTATTCTGTCTCTCTCTTCTACGATTATTCTTGAGGCTATCCG
TGATACTTCGTTGCAATCGTTATTGAAAAATTGCGCATATGGTAATAATTACAAACTTAATGCTAAATCAGGGATAGAAC
TTTTGAATAAAGCCTTGAAGACAGAAGTAAGAAGCGATAAACTAAAATCTTTTTTATATGAACAACAAAAAACGCTAAAC
CAACTGTTGTATATCGAACAGCATGCTATCAGAACTGAATTAACTTTATATTATAGCTACAAAACAATAAACAGTTATCC
TCATACGATACACGAATCGACAGAATTGAATTATCTTGAAATCACTATACGGATTTGGTGTATGCCTCTGTTGGACGGTG
AAATTGAGGTATATTTATATGATATTGATGGGAGTGATTCCAACCCACCGGTCGAATCGTTATTTTCCGAGACTAATATC
GTACAGATAGATGCCCTACAGGGCGTGGCAGTAGTCCGTTTTGAAGTGGAAGATCCTGTAAATAACACCCGCAAATTTAG
AGGTGGTACGCTAAAAATTATGGTGCGGATTAAAAATTCAGAAGGCCAGTATTTACCAACTATTAACGGCATTCCACACG
GTATAGCCTCCTATTTTCCGTATCAAAATAGTTTCAAAACAATAGTTACAGAAATAAAAGCAGGCGGTCAGACTCGTTAT
AACAAGAAGCATAAAGAGATAATTAAATATGATAAATTATATACATCGCCACCAGCAGACAGGGAAGAATTGGAAATTAT
GGAACAAAAAACAAAAAACAATGAAAGGTCATAA