Detailed information of effector


Summary

Effector ID EFF01807 experimental
Effector type Tde
Cognate immunity protein IMU00325 experimental; IMU00326 experimental
Related T6SS (Type) T6SS00272 experimental (Type i1)
Strain Proteus mirabilis HI4320
Replicon chromosome
Sequence Protein sequence (525 a.a.); Nucleotide sequence (1575 bp)
Description PefD alone is toxic in E. coliand PefE protects from the toxicity of PefD
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PMI0755 (pefD)
Coordinates (Strand) 837094..838668 (+)
NCBI ID 501336092
RefSeq NC_010554
Uniprot ID B4EVA8_PROMH
KEGG ID pmr:PMI0755
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 8e-25 22..127
Tox-GHH2 PF15635.8 8.5e-09 413..497

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-524 MDTRVYVNGREICSKASDGVSTAAFPDPCWSPGPSVVPYPNTSSADALSNGTATVFIRNSMVAQEDRSFFSISTGDEPATNGLAKGVITGVIKGKAYFRSWSLNVKFEGYGVARHQDLMSHNHGSFPSNTPTFPYISRGVLGGIKDCSKENTQIEKRCKPDKDNSDVQQELKKESALRKALARRKKIQNKKNSNKWHWTEDHCAGLEIKMSGKDPKKVAKEFMDDISDSIDALKSELDYVSALKSKLTDMAKDAASKAFGKVITKAGIKQVAGSSVPGWGNAAMAAWTLGDAVYAGFEVSTIKSAAEEGLEQVKVLSEKADDIKKLIEQTENYKNLSPEEQLEKAQKLAEDAQDILASLNACVRARKCNLVPYSVKNAIKKGARGSKVETAKKGGCCQGQTGHHLIYSHLLRETCKNYEESIAPTVCVEGTSWHSGSHGRIHMAMDDEITYLVENNRLNNNTMSMQQAIDAAVNAHKKTFPYADCSNRCIRAQLESYYLSICKDARLPAKDSRGNNIKYNELDR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8967 - -



  Protein sequence: 525 a.a.    .

>EFF01807 NC_010554:837094-838668 [Proteus mirabilis HI4320]
MDTRVYVNGREICSKASDGVSTAAFPDPCWSPGPSVVPYPNTSSADALSNGTATVFIRNSMVAQEDRSFFSISTGDEPAT
NGLAKGVITGVIKGKAYFRSWSLNVKFEGYGVARHQDLMSHNHGSFPSNTPTFPYISRGVLGGIKDCSKENTQIEKRCKP
DKDNSDVQQELKKESALRKALARRKKIQNKKNSNKWHWTEDHCAGLEIKMSGKDPKKVAKEFMDDISDSIDALKSELDYV
SALKSKLTDMAKDAASKAFGKVITKAGIKQVAGSSVPGWGNAAMAAWTLGDAVYAGFEVSTIKSAAEEGLEQVKVLSEKA
DDIKKLIEQTENYKNLSPEEQLEKAQKLAEDAQDILASLNACVRARKCNLVPYSVKNAIKKGARGSKVETAKKGGCCQGQ
TGHHLIYSHLLRETCKNYEESIAPTVCVEGTSWHSGSHGRIHMAMDDEITYLVENNRLNNNTMSMQQAIDAAVNAHKKTF
PYADCSNRCIRAQLESYYLSICKDARLPAKDSRGNNIKYNELDR*

  Nucleotide sequence: 1575 bp    .

>EFF01807 NC_010554:837094-838668 [Proteus mirabilis HI4320]
ATGGATACGCGAGTTTATGTTAACGGACGAGAAATTTGCTCTAAAGCATCCGATGGTGTATCAACGGCCGCGTTTCCAGA
TCCTTGCTGGTCTCCTGGCCCCTCAGTGGTTCCTTATCCTAACACCTCTAGCGCAGATGCTTTATCAAATGGTACAGCGA
CTGTTTTTATCCGAAATAGTATGGTTGCACAAGAAGATCGTTCATTCTTTTCTATTAGTACAGGAGATGAGCCAGCAACT
AATGGGTTAGCCAAAGGCGTGATAACAGGCGTTATTAAAGGTAAAGCCTATTTTCGGTCATGGTCACTTAATGTGAAGTT
TGAAGGATATGGTGTTGCACGTCATCAAGATCTTATGTCACATAATCATGGCTCTTTTCCATCTAACACACCGACATTTC
CGTATATTTCTCGAGGGGTTTTGGGCGGTATTAAAGATTGTAGCAAAGAAAATACACAGATTGAAAAGCGCTGTAAACCC
GATAAGGATAACTCGGATGTCCAACAAGAGTTAAAAAAAGAAAGTGCGCTTAGAAAAGCATTAGCAAGAAGAAAAAAAAT
ACAAAATAAAAAAAATAGCAATAAATGGCACTGGACGGAGGATCATTGTGCTGGGTTAGAAATAAAAATGTCAGGGAAAG
ATCCTAAAAAAGTTGCTAAAGAGTTTATGGATGATATTTCTGATTCGATAGACGCATTAAAAAGCGAATTAGATTATGTT
AGTGCATTAAAAAGTAAACTTACTGATATGGCAAAGGATGCCGCATCAAAAGCATTCGGTAAGGTAATCACAAAGGCTGG
AATAAAACAAGTAGCAGGTAGCTCAGTTCCAGGTTGGGGAAATGCGGCAATGGCCGCATGGACACTTGGTGATGCAGTCT
ATGCAGGTTTTGAGGTTAGCACTATTAAATCAGCTGCTGAAGAGGGACTAGAACAAGTTAAAGTCTTATCTGAAAAAGCG
GATGATATAAAAAAATTGATCGAACAAACTGAAAATTATAAAAACTTATCACCTGAAGAGCAGCTAGAAAAAGCACAAAA
ATTGGCTGAAGATGCACAAGATATTCTTGCTAGCTTAAATGCTTGTGTTCGAGCAAGAAAATGCAATTTAGTCCCTTATT
CTGTAAAAAATGCGATAAAAAAAGGTGCCAGAGGAAGTAAAGTAGAGACCGCGAAAAAAGGAGGATGTTGCCAAGGACAA
ACGGGGCATCATTTAATTTACTCTCATTTGTTAAGAGAGACATGTAAGAATTATGAGGAGTCCATAGCCCCTACTGTTTG
TGTGGAAGGTACGTCTTGGCATAGTGGTAGTCATGGGCGTATTCATATGGCGATGGATGATGAAATTACTTATTTAGTTG
AAAATAATCGATTAAATAATAACACTATGAGTATGCAACAAGCTATTGATGCTGCCGTTAATGCCCATAAAAAAACGTTT
CCATATGCTGATTGTTCCAATAGATGTATTAGAGCTCAATTAGAAAGTTATTATTTATCAATATGCAAAGATGCAAGATT
ACCCGCGAAAGACTCGAGGGGTAATAACATAAAATATAACGAACTAGATAGGTGA