Detailed information of effector


Summary

Effector ID EFF01522 experimental
Effector type Tde
Cognate immunity protein IMU00322 experimental; IMU00323 experimental; IMU00324 experimental
Related T6SS (Type) T6SS00944 experimental (Type Unknown)
Strain Escherichia coli strain PE086
Replicon chromosome
Sequence Protein sequence (450 a.a.); Nucleotide sequence (1350 bp)
Description Hcp-ET3 with a C-terminal pyocin S3 toxin,witch is cytotoxic by virtue of its DNase activity.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) het1 (Hcp-ET3)
Coordinates (Strand) 81..1430 (+)
NCBI ID 1062685123
GenBank KX118289
Uniprot ID A0A1C9CJD4_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Pyocin_S PF06958.14 9e-23 309..416
T6SS_HCP PF05638.14 3.2e-13 28..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-449 VGDIVYLRIIGEKQGDISSGCGTYASVGNRWQVGHEDEIFAFALTNAITSTGNGVNLQGLQFCKLIDKSSPLLSNAINQNERLFIEIDLYRINKSGRWERYYYIQLRNASLTAIHVNISDNNLPTECVTVDYDYILCKHLIANTEFDWLAFPAGYNSLFIPPKSPPASNLKPEPLPVVNLPLSSPAVNPVYAKSCLKVKGCTDAGTAEEPAENFGQVAIFVQPVVDDCCGYHHPEANVIGEPAEAQTMLLFPSSVLATQIWGKWSLSGVLSATRGSYIGALASALYIPSAGEGSARVPGRDEFWYEEELRQKALAGSTATTRVRFFWGTDIHGKPQVYGVHTGEGTPYENVRVANMQWNEQTQRYEFTPAHDVDGPLITWTPENPEHGNVPGHTGNDRPPLEQPTILVTPIPDGTDTYRRHSRFLIRKNSTIIFWFFRRDPVLSLSMFT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9790 - -



  Protein sequence: 450 a.a.    .

>EFF01522 KX118289:81-1430 [Escherichia coli]
VGDIVYLRIIGEKQGDISSGCGTYASVGNRWQVGHEDEIFAFALTNAITSTGNGVNLQGLQFCKLIDKSSPLLSNAINQN
ERLFIEIDLYRINKSGRWERYYYIQLRNASLTAIHVNISDNNLPTECVTVDYDYILCKHLIANTEFDWLAFPAGYNSLFI
PPKSPPASNLKPEPLPVVNLPLSSPAVNPVYAKSCLKVKGCTDAGTAEEPAENFGQVAIFVQPVVDDCCGYHHPEANVIG
EPAEAQTMLLFPSSVLATQIWGKWSLSGVLSATRGSYIGALASALYIPSAGEGSARVPGRDEFWYEEELRQKALAGSTAT
TRVRFFWGTDIHGKPQVYGVHTGEGTPYENVRVANMQWNEQTQRYEFTPAHDVDGPLITWTPENPEHGNVPGHTGNDRPP
LEQPTILVTPIPDGTDTYRRHSRFLIRKNSTIIFWFFRRDPVLSLSMFT*

  Nucleotide sequence: 1350 bp    .

>EFF01522 KX118289:81-1430 [Escherichia coli]
GTGGGCGATATTGTTTACCTGAGAATAATCGGTGAGAAGCAGGGCGATATTTCTTCAGGCTGTGGGACGTATGCGTCGGT
TGGTAATCGCTGGCAGGTTGGCCATGAAGATGAAATTTTTGCCTTTGCACTCACCAACGCCATTACCAGTACTGGTAATG
GCGTTAATCTACAGGGGCTACAATTTTGCAAACTCATTGATAAAAGCTCACCGCTACTGTCTAATGCCATCAATCAGAAT
GAGCGGTTATTTATTGAAATCGATTTGTATCGTATAAATAAAAGCGGGCGATGGGAACGGTATTATTATATTCAGCTAAG
AAATGCTTCATTAACTGCTATTCATGTAAACATTTCTGACAATAATCTTCCTACCGAATGTGTAACTGTCGATTATGACT
ACATATTATGTAAACATCTCATAGCCAATACGGAATTTGACTGGTTGGCCTTTCCTGCTGGCTATAATAGCTTATTTATT
CCGCCTAAAAGTCCACCTGCCAGTAATCTTAAGCCTGAACCGCTACCAGTTGTTAACCTTCCACTCTCTTCACCAGCGGT
TAACCCGGTCTATGCCAAATCCTGTCTGAAGGTGAAGGGATGTACAGATGCCGGAACGGCAGAAGAACCCGCTGAAAACT
TCGGTCAAGTAGCGATTTTCGTTCAGCCAGTGGTTGATGACTGCTGTGGATACCACCATCCCGAGGCTAACGTTATCGGG
GAACCCGCAGAAGCTCAAACCATGCTACTGTTCCCGAGTAGTGTGTTGGCGACTCAAATATGGGGAAAATGGTCGCTCAG
TGGCGTACTCAGTGCAACCCGCGGCTCTTACATCGGTGCGTTGGCATCTGCTCTGTATATTCCCTCTGCGGGTGAGGGCA
GTGCTCGTGTGCCTGGACGTGATGAGTTCTGGTATGAGGAAGAACTGCGGCAGAAAGCACTAGCAGGCAGTACCGCCACC
ACCCGGGTGCGTTTTTTCTGGGGAACTGACATTCACGGCAAGCCTCAGGTGTATGGTGTTCATACGGGTGAAGGTACGCC
GTATGAAAACGTCCGCGTGGCGAACATGCAGTGGAACGAGCAGACGCAGCGTTATGAATTTACCCCCGCTCACGATGTCG
ATGGCCCCCTGATTACCTGGACGCCGGAAAATCCGGAACATGGGAATGTTCCGGGCCATACCGGTAACGACAGGCCGCCG
CTGGAGCAGCCCACCATTCTGGTGACGCCGATTCCGGACGGCACCGATACCTATCGCCGCCATTCCCGGTTCCTGATCCG
AAAGAATTCAACGATTATATTCTGGTTTTTCCGGCGGGATCCGGTATTAAGCCTATCTATGTTTACCTGA