Detailed information of effector


Summary

Effector ID EFF01501 experimental
Effector type Tle
Cognate immunity protein IMU00316 experimental; IMU00318 experimental
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (551 a.a.); Nucleotide sequence (1653 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_0927 (Slp)
Coordinates (Strand) 971234..972886 (+)
NCBI ID 560172775
GenBank HG326223
Uniprot ID UPI000326BCCD
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-550 VIILPIPYLGVTQKIRISNALSFANARRNQKKSPIWRAALRWRVCADHGTLRVGRRRMKLIHFSSEHTAPESFSRILNPTAARYELERHYLFGGAAGISISSRYPITRNTQSGIGVTGYREDVAVKRSVLDEINRGGLLAIDQGMGTWTPTKYAFYVDAEGRLQRYPGSSLPAFYPIGRVIARYEEMVSRYGHRAKPTVLPARQNTTRNPPLQQAIATAVATVAATVQAIRPLTKAERWQERQYLIGRGNRSIYPDARMAAQRLAENNVAVEKAKLAENVYKTTNPLKDTIDIPEGWKDISNNDGALGRLGLSSNMLYDKPMNPDFLARVYQPDESIFGKAMNPTVVFRGSRAPEFPEGISRATQKALIRGDLSGIKNLSDWKNNGAQGIGLNSEYYKKAVGIGDKISKVSNIDVAGHSLGGGMASAASMASGKPAWTFNAAGLHAGTVEKYGGSIIGSVDNIQAYRVKGELLTKLQEVDLWEDAKDLKFYPPAVMAKERLSLLAPDAVGVKHTLSGGTGSLLDKHGIDQAIQCIENEKDDDIATIKGRI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8759 - -



  Protein sequence: 551 a.a.    .

>EFF01501 HG326223:971234-972886 [Serratia marcescens subsp. marcescens Db11]
VIILPIPYLGVTQKIRISNALSFANARRNQKKSPIWRAALRWRVCADHGTLRVGRRRMKLIHFSSEHTAPESFSRILNPT
AARYELERHYLFGGAAGISISSRYPITRNTQSGIGVTGYREDVAVKRSVLDEINRGGLLAIDQGMGTWTPTKYAFYVDAE
GRLQRYPGSSLPAFYPIGRVIARYEEMVSRYGHRAKPTVLPARQNTTRNPPLQQAIATAVATVAATVQAIRPLTKAERWQ
ERQYLIGRGNRSIYPDARMAAQRLAENNVAVEKAKLAENVYKTTNPLKDTIDIPEGWKDISNNDGALGRLGLSSNMLYDK
PMNPDFLARVYQPDESIFGKAMNPTVVFRGSRAPEFPEGISRATQKALIRGDLSGIKNLSDWKNNGAQGIGLNSEYYKKA
VGIGDKISKVSNIDVAGHSLGGGMASAASMASGKPAWTFNAAGLHAGTVEKYGGSIIGSVDNIQAYRVKGELLTKLQEVD
LWEDAKDLKFYPPAVMAKERLSLLAPDAVGVKHTLSGGTGSLLDKHGIDQAIQCIENEKDDDIATIKGRI*

  Nucleotide sequence: 1653 bp    .

>EFF01501 HG326223:971234-972886 [Serratia marcescens subsp. marcescens Db11]
GTGATAATTTTGCCCATACCCTATTTAGGCGTGACACAGAAGATAAGGATATCCAATGCGTTATCGTTCGCTAACGCTCG
ACGAAACCAGAAAAAGTCGCCCATCTGGCGAGCTGCACTGCGATGGCGCGTCTGTGCCGACCACGGAACCTTACGAGTGG
GCAGGCGCCGTATGAAACTGATTCATTTCTCCTCTGAACACACGGCGCCGGAAAGCTTTTCCAGGATACTTAACCCTACA
GCAGCGCGGTATGAGCTGGAACGGCATTATCTGTTCGGCGGCGCAGCCGGCATATCGATAAGCAGCCGGTATCCGATTAC
CCGCAATACTCAATCCGGGATTGGCGTCACCGGTTATCGTGAGGACGTGGCTGTGAAGCGCAGCGTGCTCGATGAGATCA
ACCGGGGCGGCTTGCTGGCGATTGATCAGGGAATGGGCACCTGGACGCCGACGAAATATGCTTTTTACGTCGACGCGGAA
GGCCGATTACAGCGTTATCCAGGCAGCTCTCTTCCCGCCTTTTATCCTATCGGGCGCGTGATCGCCCGCTATGAAGAAAT
GGTCAGCCGCTATGGCCACCGGGCAAAACCGACGGTGCTGCCGGCGAGGCAGAATACGACCCGGAATCCCCCTCTGCAGC
AAGCCATCGCGACCGCAGTAGCAACCGTTGCCGCCACGGTGCAGGCCATCCGTCCGCTGACCAAGGCAGAACGCTGGCAA
GAACGCCAGTACCTGATAGGGCGAGGCAACCGCAGCATTTACCCGGATGCGCGCATGGCGGCACAGCGCCTGGCGGAGAA
CAACGTCGCGGTCGAAAAGGCGAAGTTGGCTGAGAATGTTTACAAGACCACTAATCCGCTCAAGGACACGATAGACATCC
CTGAAGGCTGGAAGGATATCAGTAACAATGATGGGGCGCTGGGCCGGCTTGGTTTGAGCAGTAACATGCTTTATGACAAA
CCAATGAATCCTGACTTTTTAGCCCGAGTTTATCAGCCAGACGAAAGTATCTTTGGCAAGGCGATGAACCCGACGGTGGT
ATTCCGCGGATCGCGGGCACCAGAATTCCCGGAGGGAATAAGCCGCGCAACCCAAAAAGCCTTAATAAGGGGTGACTTAT
CAGGCATTAAAAATCTCAGTGACTGGAAAAACAACGGTGCTCAGGGAATAGGGCTTAATTCTGAATACTACAAAAAAGCG
GTTGGTATTGGCGATAAAATTTCAAAGGTATCCAATATCGACGTTGCAGGTCACTCATTAGGCGGTGGCATGGCGTCTGC
TGCCTCCATGGCCAGCGGCAAGCCAGCTTGGACGTTTAATGCCGCTGGATTGCATGCGGGAACCGTAGAAAAATACGGCG
GCTCTATAATAGGCAGTGTCGATAATATTCAGGCGTATCGCGTAAAAGGGGAACTGTTGACCAAGCTGCAGGAGGTTGAT
TTGTGGGAGGATGCCAAAGACCTCAAATTTTATCCGCCGGCGGTGATGGCGAAAGAACGGTTGTCCCTGTTGGCGCCTGA
CGCCGTGGGAGTAAAACACACGCTTTCCGGTGGAACAGGCTCACTGCTGGATAAGCACGGTATAGACCAGGCGATACAAT
GCATTGAAAATGAAAAAGACGATGACATTGCCACAATCAAGGGAAGAATATGA