Detailed information of effector


Summary

Effector ID EFF00996 experimental
Effector type Tae
Cognate immunity protein IMU00053 experimental; IMU00192 experimental
Related T6SS (Type) T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome
Sequence Protein sequence (167 a.a.); Nucleotide sequence (501 bp)
Description Tae; amidase
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Atu4347 (Tae4)
Coordinates (Strand) 1480980..1481480 (+)
NCBI ID 159186127
RefSeq NC_003063
Uniprot ID Q7CUP8_AGRFC
KEGG ID atu:Atu4347
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 7.8e-19 43..158

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-166 MRVNFDTLYSNYPSSDPSHPNYLSQRDLFTEIGWESFIGNPNYHNTCAIRVSIAFVKSGINIVPSSHRIQKGPYAGKGIEVNMRRLATLMKRTSYLGEPDPYTPATARNGIGARNGVVAFNNIPGYTGGGHIDLVRGGSEATQCASACYYNSETIWFWPLQASRGS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9829 - -



  Protein sequence: 167 a.a.    .

>EFF00996 NC_003063:1480980-1481480 [Agrobacterium fabrum str. C58]
MRVNFDTLYSNYPSSDPSHPNYLSQRDLFTEIGWESFIGNPNYHNTCAIRVSIAFVKSGINIVPSSHRIQKGPYAGKGIE
VNMRRLATLMKRTSYLGEPDPYTPATARNGIGARNGVVAFNNIPGYTGGGHIDLVRGGSEATQCASACYYNSETIWFWPL
QASRGS*

  Nucleotide sequence: 501 bp    .

>EFF00996 NC_003063:1480980-1481480 [Agrobacterium fabrum str. C58]
ATGCGCGTTAACTTTGACACCCTCTATAGCAATTATCCGAGCAGCGATCCGTCGCATCCGAATTATCTCAGCCAGCGTGA
TCTGTTCACGGAAATCGGCTGGGAGAGCTTCATCGGCAATCCGAACTATCATAATACCTGCGCCATCCGCGTCAGCATCG
CTTTCGTGAAGTCGGGCATCAACATCGTGCCCTCTTCGCACCGCATCCAGAAGGGCCCCTATGCCGGAAAGGGCATCGAG
GTGAACATGCGCCGCCTTGCCACCCTGATGAAGCGGACGAGCTATCTCGGCGAGCCCGATCCTTACACGCCCGCCACCGC
CCGCAACGGCATCGGCGCGCGCAACGGTGTCGTGGCCTTCAACAATATTCCCGGCTACACCGGTGGCGGTCATATCGATC
TCGTGCGCGGCGGGTCGGAAGCCACCCAATGCGCGTCGGCCTGCTACTACAATTCGGAAACGATCTGGTTCTGGCCGCTG
CAGGCCAGCCGCGGGTCCTGA