Detailed information of accessory protein


Summary

Accessory protein ID ACP00024 experimental
Type adaptor
Related T6SS (Type) T6SS00367 (Type i1)
Strain Escherichia coli O111:H- str. 11128
Replicon chromosome
Related structure protein ECO111_0596 (VgrGO1)
Related effector ECO111_0594 (Rhs-CT3)
Description Essential for the antibacterial activity of Rhs-CT3
Reference [1] Ma J, Sun M, Dong W, et al. PAAR-Rhs proteins harbor various C-terminal toxins to diversify the antibacterial pathways of type VI secretion systems. Environ Microbiol. 2017 Jan;19(1):345-360. doi: 10.1111/1462-2920.13621. Epub 2017 Jan 18. PMID: 27871130
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECO111_0594 (eagR)
Coordinates (Strand) 632578..637377 (-)
NCBI ID 447211780
RefSeq NC_013364
Uniprot ID A0A1C9CJL1_ECOLX, I2ULT2_ECOLX, K4URT5_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-REase-3 PF15647.8 1.6e-33 1493..1595
DUF6531 PF20148.1 1.8e-10 393..459
PAAR_motif PF05488.15 1e-08 266..310
RHS_repeat PF05593.16 2.3e-07 679..716
RHS_repeat PF05593.16 2.6e-06 869..904
RHS_repeat PF05593.16 6e-06 976..1009
RHS_repeat PF05593.16 8.6e-06 721..759
RHS_repeat PF05593.16 2e-05 618..653

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1599 MSEGPGGPQGATAGGTLAMRMLSQQAMVASQMKRAANDKAIAQMLAAKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSENVNINGKPAARAAVTLPPPPPPGAIPEIPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTESNAGFMDRVSAGASLLFPAGPVLMEFATMVGGRSEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNLLGKSGKQLGAKLGALLGKTGKSLKSIANKVIRWVTDPVVPVTGAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLNFAFDGDSDTAVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPDDRMYMLGGMSDTASNRITFERDSQYRITGVSHTDGIRLKLTYHASGYLKAIHRTDNGIQTLATYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGRCVNVTGAEGYYNATLDYGDGCTTVTDGKGTHRYYYDPDGNILREEAPDGSTTTYEWDEFHHLLARHSPAGRVEKFEYNAALGQLSRYTAADGAEWLYRYDERGLLSNITDPAGQTWTQQCDERGLPVSLVSPQGEETRLAYTAQGLLSGIFRQDERRLGIEYDHHNRPETLTDVMGREHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAETGAEGFRYDRHGNLLAYTDGNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYRYILDNCGRVTEERDWGGVVWRYRYDADGLCTARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKSGRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIRCILPPEDERDRHPDESLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQPVSQRAGFFPEETTWGGLLPSLVREYRYDSAGNVSAVTSREDYGRETRREYRLDRNGQVTAVTASGTGLGYGEGDESYGYDSCGYLKAQSAGRHRISEETDQYAGGHRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRHDASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQAHPSVAPQWVTRTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGEWDPEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPLGYIDPLGLAKTSVPAEKISLSDKARDLFRQGKVREALDVHYEDLVRRKLGGISQEIAGREYDVVTDKIIAQVKRTYSSIDNPKNFLSKSTRTQIKKTIELAEEQGKEAQFWFKYGVSPKVREYIESKGGKVILGMGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9164 - -



  Protein sequence: 1600 a.a.    

>ACP00024 NC_013364:c637377-632578 [Escherichia coli O111:H- str. 11128]
MSEGPGGPQGATAGGTLAMRMLSQQAMVASQMKRAANDKAIAQMLAAKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVT
IAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSENVNINGKPAARAAVTLPPP
PPPGAIPEIPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTESNAGFMDRVSAGASLLFPAGPVLMEFATMVGGR
SEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGSPDVFIGGEQVTYLDIQPEFPP
WQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNLLGKSGKQLGAKLGALLGKTGKSLKSIANKVIRWVTDPVVPVTG
AYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLNFAFDGDSDTAVNPYHA
QYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPDDRMYMLGGMSDTASNRITFERDSQYRITG
VSHTDGIRLKLTYHASGYLKAIHRTDNGIQTLATYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYD
AQGRCVNVTGAEGYYNATLDYGDGCTTVTDGKGTHRYYYDPDGNILREEAPDGSTTTYEWDEFHHLLARHSPAGRVEKFE
YNAALGQLSRYTAADGAEWLYRYDERGLLSNITDPAGQTWTQQCDERGLPVSLVSPQGEETRLAYTAQGLLSGIFRQDER
RLGIEYDHHNRPETLTDVMGREHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAETGAEGFRYDRHGNLLAYTD
GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYRYILDNCGRVTEERDWGGVVWRYRYDADGLC
TARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKSGRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEH
TVIRCILPPEDERDRHPDESLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQPVSQR
AGFFPEETTWGGLLPSLVREYRYDSAGNVSAVTSREDYGRETRREYRLDRNGQVTAVTASGTGLGYGEGDESYGYDSCGY
LKAQSAGRHRISEETDQYAGGHRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQAHPSVAPQWVTRTNHAVSD
LTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGEWDPEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMY
LVSDPLGLQGGEQTYRYVPNPLGYIDPLGLAKTSVPAEKISLSDKARDLFRQGKVREALDVHYEDLVRRKLGGISQEIAG
REYDVVTDKIIAQVKRTYSSIDNPKNFLSKSTRTQIKKTIELAEEQGKEAQFWFKYGVSPKVREYIESKGGKVILGMGN*

  Nucleotide sequence: 4800 bp    

>ACP00024 NC_013364:c637377-632578 [Escherichia coli O111:H- str. 11128]
ATGAGTGAAGGACCTGGCGGGCCACAGGGAGCGACCGCAGGCGGTACGCTGGCAATGCGAATGCTGTCACAGCAGGCGAT
GGTCGCCAGCCAGATGAAACGGGCAGCCAACGACAAAGCCATTGCACAGATGCTGGCAGCAAAGAAGTCCGGCCCACCTG
CCGCCAGGCTGGGCGATGAAATTCAGCATAAAAGTTTTCTGGGGGCACTGGCAGGGGCCGTGCTGGGGGCGATAGTGACC
ATCGCAGAAGGTTGCCTGATTATGGCCGCCTGCGCCACCGGCCCTTATGCGCTGGTTCTGGTGCCTGCGCTGATGTATGC
CAGCTATAAGGCGAGTGATTATGTGGAGGAGAAACAGAACCAGCTTGAATCATGGATAAACAGCTTTTGTGACACGGACG
GCGCCATCAATACCGGTTCTGAAAATGTAAACATTAACGGAAAGCCCGCTGCAAGGGCCGCCGTCACCCTTCCCCCTCCT
CCCCCACCTGGAGCAATACCTGAAATCCCACAGGGGGAACCCTCATGGGGTGATATTGCCACTGACCTGCTTGAATCGGC
AGCGGAAAAAGCAGTACCACTGGCGAAGGCCTGGGGGAACGCTGTTATCACCCTGACGGAAAGCAATGCCGGTTTTATGG
ATCGCGTCAGCGCCGGCGCATCGCTTCTGTTTCCCGCCGGTCCGGTATTAATGGAGTTTGCCACCATGGTGGGCGGGCGT
AGCGAAATCAAAAAAGATGTGGATTTCCCGGAAGCCGGTGAGGACACGGCGCTCTGCGACAAGGAGAACAAACCACCGAG
GATAGCCCAGGGCAGTAGCAACGTCTTTATCAACAATCAGCCTGCCGCGCGCAAGGGCGACAAACTGGAGTGCAGTGCGG
CGATCGTGGGAGGTTCGCCGGACGTCTTTATTGGCGGTGAACAGGTGACCTATCTGGATATCCAGCCGGAGTTCCCGCCG
TGGCAGAGAATGATCCTGGGGGGAATAACGATAGCCAGCTATCTTCTGCCGCCTGCGGGACTGCTGGGAAAACTGAAGAA
TCTGGCGAGACTCGGCAAACTGGGAAACCTGCTGGGGAAAAGCGGGAAGCAGCTGGGCGCAAAGCTCGGCGCGTTGCTGG
GGAAAACAGGTAAGTCGTTAAAAAGTATTGCCAATAAAGTCATCAGATGGGTAACAGATCCTGTCGTTCCGGTAACCGGC
GCATACTGCGACGAACGTACCGACTTCACCCTGGGCCAGACCCTCCCCCTCTCCTTCACCCGTTTCCACAGTTCTGTACT
GCCGCTGCATGGCCTGACCGGCGTGGGCTGGAGCGACTCCTGGAGCGAATACGCCTGGGTGCGTGAACAGGGAAATCGGG
TAGATATTATCAGCCAGGGAGCCACGCTGAACTTCGCCTTCGACGGTGACAGTGATACGGCGGTTAACCCGTATCACGCC
CAGTACATTCTGCGCCGCCGCGACGATTACCTGGAGCTGTTCGACAGGGATGCACTGAGCAGCCGCTTCTTTTATGACGC
CTTTCCGGGAATGCGTCTGCGCCACCCGGTGACTGACGATACCAGCGATGACCGCCTGGCACACAGCCCCGACGACCGGA
TGTATATGCTGGGCGGGATGAGCGACACCGCCAGCAACCGCATCACGTTTGAGCGCGACAGCCAGTACCGGATCACGGGT
GTCAGTCACACCGACGGGATCCGGCTTAAACTGACGTACCACGCCAGCGGCTACCTGAAAGCCATTCACCGCACGGATAA
CGGCATACAGACGCTGGCGACCTACGAACAGGATGCGCGGGGGCGGCTGACAGAAGCGGATGCGCGGCTGGACTACCACC
TGTTTTATGAGTACGACGCTGCGGACCGGATCATCCGCTGGTCCGATAACGACCAGACGTGGAGCCGTTTCACCTACGAT
GCACAGGGCCGGTGCGTGAATGTCACCGGGGCGGAGGGCTATTACAACGCCACGCTGGACTATGGTGACGGCTGCACCAC
CGTGACGGACGGCAAGGGCACTCACCGTTATTACTATGATCCTGACGGCAATATTCTGCGGGAAGAAGCGCCGGACGGCA
GTACCACCACGTATGAATGGGATGAATTCCATCACCTGCTGGCCCGCCACTCCCCTGCCGGGCGGGTGGAGAAGTTTGAA
TACAACGCCGCACTCGGTCAGTTAAGCCGTTACACGGCGGCAGACGGCGCGGAGTGGCTGTACCGCTATGATGAGCGCGG
CCTGCTCAGCAACATCACCGACCCTGCCGGGCAGACATGGACGCAGCAGTGTGATGAGCGCGGCCTGCCGGTAAGCCTGG
TGTCGCCACAGGGCGAAGAGACCCGGCTGGCATACACCGCTCAGGGGCTGCTGTCGGGGATATTCCGCCAGGATGAACGG
CGTCTGGGCATAGAGTACGACCACCACAACCGGCCGGAAACACTCACCGACGTGATGGGCCGTGAACACCACACCGAATA
CAGCGGTCACGACCTGCCGGTGAAGATGCGCGGCCCCGGCGGTCAGTCAGTGCGGTTACAGTGGCAGCAGCACCATAAAC
TGAGCGGCCTTGAGCGGGCAGAAACCGGCGCAGAAGGATTCCGCTATGACCGCCACGGCAACCTGCTGGCGTACACGGAC
GGTAACGGCGTTGTCTGGACAATGGAATACGGCCCGTTCGATTTGCCGGTGGCGCGAACGGACGGTGAAGGCCACCGCTG
GCAGTACCGCTACGATAAAGACACGCTGCAGCTCACAGAAGTCATTAACCCGCAGGGCGAGTCATACCGTTATATTCTGG
ACAACTGTGGCCGGGTGACGGAAGAGCGTGACTGGGGCGGCGTGGTCTGGCGTTACCGCTATGACGCTGATGGCCTGTGT
ACCGCCAGGGTCAACGGCCTGGAGGAAACCATCCTCTACAGCCGGGACGCCGCAGGCCGCCTGGCAGAAGTCATCACGCC
GGAAGGCAAAACGCAGTATGCGTATGACAAATCCGGCAGGCTGACGGGTATCTTCAGCCCGGACGGCACATCACAGCGCA
CCGGCTATGACGAACGCGGGCGGGTGAATGTCACCACTCAGGGCCGACGGGCCATTGAATACCACTACCCCGATGAACAC
ACCGTTATCCGCTGTATCCTGCCACCGGAAGATGAACGCGACAGACACCCCGATGAATCCCTGCTGAAAACCACGTACCG
CTACAACGCCGCCGGAGAACTGACAGAGGTCATTCTGCCGGGGGATGAGACGCTGACGTTCAGCCGTGATGAGGCGGGAC
GTGAAGTGCTCCGGCACAGTAACCGGGGTTTTGCCTGTGAACAGGGCTGGAATGCAGCCGGCCAGCCTGTCAGTCAGCGC
GCCGGATTTTTTCCGGAGGAAACCACATGGGGCGGGCTGCTCCCCTCACTGGTACGGGAGTACCGTTACGACAGCGCGGG
CAATGTGTCGGCTGTCACCAGCCGGGAAGATTACGGACGGGAAACCCGGCGGGAGTACCGGCTGGACCGGAACGGCCAGG
TCACGGCGGTGACAGCCTCAGGCACCGGGCTGGGCTATGGCGAAGGCGATGAGTCCTATGGCTATGACAGTTGTGGCTAC
CTGAAGGCGCAGTCTGCGGGCAGGCACCGGATAAGTGAAGAGACTGACCAGTATGCCGGAGGCCACCGGCTGAAACAGGC
CGGAAACACGCAGTATGACTATGACGCCGCAGGCCGGATGGTCAGCCGCACCAGACACCGTGACGGCTACCGCCCGGAAA
CAGAGCGGTTCCGGTGGGACAGCCGGGACCAGCTGACCGGGTATTGCAGCGCACAGGGTGAGCAGTGGGAATACCGCCAC
GACGCCAGCGGCAGACGAACAGAGAAACGCTGCGACCGGAAGAAAATCCGCTTCACGTACCTGTGGGACGGCGACAGTAT
TGCGGAAATCCGGGAATACCGCGATGATAAACTGTACAGCGTACGGCACCTGGTGTTTAACGGCTTTGAGCTGATAAGCC
AGCAGTTCAGCCGGGTACGGCAGGCGCATCCGTCGGTGGCCCCGCAGTGGGTGACGCGGACGAATCATGCGGTGAGCGAC
CTGACGGGCCGCCCGCTGATGCTCTTTAACAGTGAAGGTAAAACCGTCTGGCGGCCGGGACAGACCAGCCTGTGGGGGCT
GGCACTCAGCCTGCCCGCAGACACCGGCTACCCGGACCCGCGCGGGGAGTGGGACCCGGAAGCCGACCCCGGCCTGCTGT
ATGCGGGACAGTGGCAGGATGCGGAATCGGGGCTGTGCTATAACCGGTTCCGGTACTACGAGCCGGAAACCGGAATGTAC
CTGGTGAGTGATCCGCTGGGGTTGCAGGGGGGTGAGCAGACTTACCGGTATGTGCCTAATCCACTGGGGTATATTGATCC
GCTGGGGCTGGCAAAAACTTCTGTTCCCGCAGAAAAAATAAGCCTTTCGGATAAAGCAAGAGATCTTTTTAGACAAGGAA
AAGTAAGAGAAGCATTAGATGTTCATTATGAGGATCTTGTACGAAGAAAGCTTGGTGGTATATCTCAAGAAATTGCCGGG
CGTGAATATGATGTTGTTACTGACAAGATCATAGCGCAGGTCAAGAGGACTTATAGCTCTATAGATAATCCAAAAAACTT
CTTAAGTAAGTCTACTCGGACACAAATTAAGAAGACAATTGAGCTGGCTGAAGAACAGGGGAAAGAGGCTCAGTTTTGGT
TTAAATATGGAGTAAGCCCTAAAGTAAGAGAATATATAGAAAGCAAAGGTGGGAAAGTTATATTGGGTATGGGGAATTAA