Detailed information of effector


Summary

Effector ID EFF01519 experimental
Effector type Tde
Cognate immunity protein IMU00342 experimental
Related T6SS (Type) -
Strain Escherichia coli strain PE027
Replicon chromosome
Sequence Protein sequence (1600 a.a.); Nucleotide sequence (4800 bp)
Description Rhs-CT3, C-terminal REase-3 (Restriction endonuclease-3) as a member of the DNase clan and a cytoplasmic expression assay of CT3 in engineered E. coli demonstrated that CT3 abruptly inhibited cell growth
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECO111_0594 (Rhs-CT3)
Coordinates (Strand) 632578..637377 (-)
NCBI ID 447211780
RefSeq NC_013364
Uniprot ID A0A1C9CJL1_ECOLX, I2ULT2_ECOLX, K4URT5_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-REase-3 PF15647.8 1.6e-33 1493..1595
DUF6531 PF20148.1 1.8e-10 393..459
PAAR_motif PF05488.15 1e-08 266..310
RHS_repeat PF05593.16 2.3e-07 679..716
RHS_repeat PF05593.16 2.6e-06 869..904
RHS_repeat PF05593.16 6e-06 976..1009
RHS_repeat PF05593.16 8.6e-06 721..759
RHS_repeat PF05593.16 2e-05 618..653

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1599 MSEGPGGPQGATAGGTLAMRMLSQQAMVASQMKRAANDKAIAQMLAAKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSENVNINGKPAARAAVTLPPPPPPGAIPEIPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTESNAGFMDRVSAGASLLFPAGPVLMEFATMVGGRSEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNLLGKSGKQLGAKLGALLGKTGKSLKSIANKVIRWVTDPVVPVTGAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLNFAFDGDSDTAVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPDDRMYMLGGMSDTASNRITFERDSQYRITGVSHTDGIRLKLTYHASGYLKAIHRTDNGIQTLATYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGRCVNVTGAEGYYNATLDYGDGCTTVTDGKGTHRYYYDPDGNILREEAPDGSTTTYEWDEFHHLLARHSPAGRVEKFEYNAALGQLSRYTAADGAEWLYRYDERGLLSNITDPAGQTWTQQCDERGLPVSLVSPQGEETRLAYTAQGLLSGIFRQDERRLGIEYDHHNRPETLTDVMGREHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAETGAEGFRYDRHGNLLAYTDGNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYRYILDNCGRVTEERDWGGVVWRYRYDADGLCTARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKSGRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIRCILPPEDERDRHPDESLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQPVSQRAGFFPEETTWGGLLPSLVREYRYDSAGNVSAVTSREDYGRETRREYRLDRNGQVTAVTASGTGLGYGEGDESYGYDSCGYLKAQSAGRHRISEETDQYAGGHRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRHDASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQAHPSVAPQWVTRTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGEWDPEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPLGYIDPLGLAKTSVPAEKISLSDKARDLFRQGKVREALDVHYEDLVRRKLGGISQEIAGREYDVVTDKIIAQVKRTYSSIDNPKNFLSKSTRTQIKKTIELAEEQGKEAQFWFKYGVSPKVREYIESKGGKVILGMGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9164 - -



  Protein sequence: 1600 a.a.    .

>EFF01519 NC_013364:c637377-632578 [Escherichia coli O111:H- str. 11128]
MSEGPGGPQGATAGGTLAMRMLSQQAMVASQMKRAANDKAIAQMLAAKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVT
IAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSENVNINGKPAARAAVTLPPP
PPPGAIPEIPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTESNAGFMDRVSAGASLLFPAGPVLMEFATMVGGR
SEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGSPDVFIGGEQVTYLDIQPEFPP
WQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNLLGKSGKQLGAKLGALLGKTGKSLKSIANKVIRWVTDPVVPVTG
AYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLNFAFDGDSDTAVNPYHA
QYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPDDRMYMLGGMSDTASNRITFERDSQYRITG
VSHTDGIRLKLTYHASGYLKAIHRTDNGIQTLATYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYD
AQGRCVNVTGAEGYYNATLDYGDGCTTVTDGKGTHRYYYDPDGNILREEAPDGSTTTYEWDEFHHLLARHSPAGRVEKFE
YNAALGQLSRYTAADGAEWLYRYDERGLLSNITDPAGQTWTQQCDERGLPVSLVSPQGEETRLAYTAQGLLSGIFRQDER
RLGIEYDHHNRPETLTDVMGREHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAETGAEGFRYDRHGNLLAYTD
GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYRYILDNCGRVTEERDWGGVVWRYRYDADGLC
TARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKSGRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEH
TVIRCILPPEDERDRHPDESLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQPVSQR
AGFFPEETTWGGLLPSLVREYRYDSAGNVSAVTSREDYGRETRREYRLDRNGQVTAVTASGTGLGYGEGDESYGYDSCGY
LKAQSAGRHRISEETDQYAGGHRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQAHPSVAPQWVTRTNHAVSD
LTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGEWDPEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMY
LVSDPLGLQGGEQTYRYVPNPLGYIDPLGLAKTSVPAEKISLSDKARDLFRQGKVREALDVHYEDLVRRKLGGISQEIAG
REYDVVTDKIIAQVKRTYSSIDNPKNFLSKSTRTQIKKTIELAEEQGKEAQFWFKYGVSPKVREYIESKGGKVILGMGN*

  Nucleotide sequence: 4800 bp    .

>EFF01519 NC_013364:c637377-632578 [Escherichia coli O111:H- str. 11128]
ATGAGTGAAGGACCTGGCGGGCCACAGGGAGCGACCGCAGGCGGTACGCTGGCAATGCGAATGCTGTCACAGCAGGCGAT
GGTCGCCAGCCAGATGAAACGGGCAGCCAACGACAAAGCCATTGCACAGATGCTGGCAGCAAAGAAGTCCGGCCCACCTG
CCGCCAGGCTGGGCGATGAAATTCAGCATAAAAGTTTTCTGGGGGCACTGGCAGGGGCCGTGCTGGGGGCGATAGTGACC
ATCGCAGAAGGTTGCCTGATTATGGCCGCCTGCGCCACCGGCCCTTATGCGCTGGTTCTGGTGCCTGCGCTGATGTATGC
CAGCTATAAGGCGAGTGATTATGTGGAGGAGAAACAGAACCAGCTTGAATCATGGATAAACAGCTTTTGTGACACGGACG
GCGCCATCAATACCGGTTCTGAAAATGTAAACATTAACGGAAAGCCCGCTGCAAGGGCCGCCGTCACCCTTCCCCCTCCT
CCCCCACCTGGAGCAATACCTGAAATCCCACAGGGGGAACCCTCATGGGGTGATATTGCCACTGACCTGCTTGAATCGGC
AGCGGAAAAAGCAGTACCACTGGCGAAGGCCTGGGGGAACGCTGTTATCACCCTGACGGAAAGCAATGCCGGTTTTATGG
ATCGCGTCAGCGCCGGCGCATCGCTTCTGTTTCCCGCCGGTCCGGTATTAATGGAGTTTGCCACCATGGTGGGCGGGCGT
AGCGAAATCAAAAAAGATGTGGATTTCCCGGAAGCCGGTGAGGACACGGCGCTCTGCGACAAGGAGAACAAACCACCGAG
GATAGCCCAGGGCAGTAGCAACGTCTTTATCAACAATCAGCCTGCCGCGCGCAAGGGCGACAAACTGGAGTGCAGTGCGG
CGATCGTGGGAGGTTCGCCGGACGTCTTTATTGGCGGTGAACAGGTGACCTATCTGGATATCCAGCCGGAGTTCCCGCCG
TGGCAGAGAATGATCCTGGGGGGAATAACGATAGCCAGCTATCTTCTGCCGCCTGCGGGACTGCTGGGAAAACTGAAGAA
TCTGGCGAGACTCGGCAAACTGGGAAACCTGCTGGGGAAAAGCGGGAAGCAGCTGGGCGCAAAGCTCGGCGCGTTGCTGG
GGAAAACAGGTAAGTCGTTAAAAAGTATTGCCAATAAAGTCATCAGATGGGTAACAGATCCTGTCGTTCCGGTAACCGGC
GCATACTGCGACGAACGTACCGACTTCACCCTGGGCCAGACCCTCCCCCTCTCCTTCACCCGTTTCCACAGTTCTGTACT
GCCGCTGCATGGCCTGACCGGCGTGGGCTGGAGCGACTCCTGGAGCGAATACGCCTGGGTGCGTGAACAGGGAAATCGGG
TAGATATTATCAGCCAGGGAGCCACGCTGAACTTCGCCTTCGACGGTGACAGTGATACGGCGGTTAACCCGTATCACGCC
CAGTACATTCTGCGCCGCCGCGACGATTACCTGGAGCTGTTCGACAGGGATGCACTGAGCAGCCGCTTCTTTTATGACGC
CTTTCCGGGAATGCGTCTGCGCCACCCGGTGACTGACGATACCAGCGATGACCGCCTGGCACACAGCCCCGACGACCGGA
TGTATATGCTGGGCGGGATGAGCGACACCGCCAGCAACCGCATCACGTTTGAGCGCGACAGCCAGTACCGGATCACGGGT
GTCAGTCACACCGACGGGATCCGGCTTAAACTGACGTACCACGCCAGCGGCTACCTGAAAGCCATTCACCGCACGGATAA
CGGCATACAGACGCTGGCGACCTACGAACAGGATGCGCGGGGGCGGCTGACAGAAGCGGATGCGCGGCTGGACTACCACC
TGTTTTATGAGTACGACGCTGCGGACCGGATCATCCGCTGGTCCGATAACGACCAGACGTGGAGCCGTTTCACCTACGAT
GCACAGGGCCGGTGCGTGAATGTCACCGGGGCGGAGGGCTATTACAACGCCACGCTGGACTATGGTGACGGCTGCACCAC
CGTGACGGACGGCAAGGGCACTCACCGTTATTACTATGATCCTGACGGCAATATTCTGCGGGAAGAAGCGCCGGACGGCA
GTACCACCACGTATGAATGGGATGAATTCCATCACCTGCTGGCCCGCCACTCCCCTGCCGGGCGGGTGGAGAAGTTTGAA
TACAACGCCGCACTCGGTCAGTTAAGCCGTTACACGGCGGCAGACGGCGCGGAGTGGCTGTACCGCTATGATGAGCGCGG
CCTGCTCAGCAACATCACCGACCCTGCCGGGCAGACATGGACGCAGCAGTGTGATGAGCGCGGCCTGCCGGTAAGCCTGG
TGTCGCCACAGGGCGAAGAGACCCGGCTGGCATACACCGCTCAGGGGCTGCTGTCGGGGATATTCCGCCAGGATGAACGG
CGTCTGGGCATAGAGTACGACCACCACAACCGGCCGGAAACACTCACCGACGTGATGGGCCGTGAACACCACACCGAATA
CAGCGGTCACGACCTGCCGGTGAAGATGCGCGGCCCCGGCGGTCAGTCAGTGCGGTTACAGTGGCAGCAGCACCATAAAC
TGAGCGGCCTTGAGCGGGCAGAAACCGGCGCAGAAGGATTCCGCTATGACCGCCACGGCAACCTGCTGGCGTACACGGAC
GGTAACGGCGTTGTCTGGACAATGGAATACGGCCCGTTCGATTTGCCGGTGGCGCGAACGGACGGTGAAGGCCACCGCTG
GCAGTACCGCTACGATAAAGACACGCTGCAGCTCACAGAAGTCATTAACCCGCAGGGCGAGTCATACCGTTATATTCTGG
ACAACTGTGGCCGGGTGACGGAAGAGCGTGACTGGGGCGGCGTGGTCTGGCGTTACCGCTATGACGCTGATGGCCTGTGT
ACCGCCAGGGTCAACGGCCTGGAGGAAACCATCCTCTACAGCCGGGACGCCGCAGGCCGCCTGGCAGAAGTCATCACGCC
GGAAGGCAAAACGCAGTATGCGTATGACAAATCCGGCAGGCTGACGGGTATCTTCAGCCCGGACGGCACATCACAGCGCA
CCGGCTATGACGAACGCGGGCGGGTGAATGTCACCACTCAGGGCCGACGGGCCATTGAATACCACTACCCCGATGAACAC
ACCGTTATCCGCTGTATCCTGCCACCGGAAGATGAACGCGACAGACACCCCGATGAATCCCTGCTGAAAACCACGTACCG
CTACAACGCCGCCGGAGAACTGACAGAGGTCATTCTGCCGGGGGATGAGACGCTGACGTTCAGCCGTGATGAGGCGGGAC
GTGAAGTGCTCCGGCACAGTAACCGGGGTTTTGCCTGTGAACAGGGCTGGAATGCAGCCGGCCAGCCTGTCAGTCAGCGC
GCCGGATTTTTTCCGGAGGAAACCACATGGGGCGGGCTGCTCCCCTCACTGGTACGGGAGTACCGTTACGACAGCGCGGG
CAATGTGTCGGCTGTCACCAGCCGGGAAGATTACGGACGGGAAACCCGGCGGGAGTACCGGCTGGACCGGAACGGCCAGG
TCACGGCGGTGACAGCCTCAGGCACCGGGCTGGGCTATGGCGAAGGCGATGAGTCCTATGGCTATGACAGTTGTGGCTAC
CTGAAGGCGCAGTCTGCGGGCAGGCACCGGATAAGTGAAGAGACTGACCAGTATGCCGGAGGCCACCGGCTGAAACAGGC
CGGAAACACGCAGTATGACTATGACGCCGCAGGCCGGATGGTCAGCCGCACCAGACACCGTGACGGCTACCGCCCGGAAA
CAGAGCGGTTCCGGTGGGACAGCCGGGACCAGCTGACCGGGTATTGCAGCGCACAGGGTGAGCAGTGGGAATACCGCCAC
GACGCCAGCGGCAGACGAACAGAGAAACGCTGCGACCGGAAGAAAATCCGCTTCACGTACCTGTGGGACGGCGACAGTAT
TGCGGAAATCCGGGAATACCGCGATGATAAACTGTACAGCGTACGGCACCTGGTGTTTAACGGCTTTGAGCTGATAAGCC
AGCAGTTCAGCCGGGTACGGCAGGCGCATCCGTCGGTGGCCCCGCAGTGGGTGACGCGGACGAATCATGCGGTGAGCGAC
CTGACGGGCCGCCCGCTGATGCTCTTTAACAGTGAAGGTAAAACCGTCTGGCGGCCGGGACAGACCAGCCTGTGGGGGCT
GGCACTCAGCCTGCCCGCAGACACCGGCTACCCGGACCCGCGCGGGGAGTGGGACCCGGAAGCCGACCCCGGCCTGCTGT
ATGCGGGACAGTGGCAGGATGCGGAATCGGGGCTGTGCTATAACCGGTTCCGGTACTACGAGCCGGAAACCGGAATGTAC
CTGGTGAGTGATCCGCTGGGGTTGCAGGGGGGTGAGCAGACTTACCGGTATGTGCCTAATCCACTGGGGTATATTGATCC
GCTGGGGCTGGCAAAAACTTCTGTTCCCGCAGAAAAAATAAGCCTTTCGGATAAAGCAAGAGATCTTTTTAGACAAGGAA
AAGTAAGAGAAGCATTAGATGTTCATTATGAGGATCTTGTACGAAGAAAGCTTGGTGGTATATCTCAAGAAATTGCCGGG
CGTGAATATGATGTTGTTACTGACAAGATCATAGCGCAGGTCAAGAGGACTTATAGCTCTATAGATAATCCAAAAAACTT
CTTAAGTAAGTCTACTCGGACACAAATTAAGAAGACAATTGAGCTGGCTGAAGAACAGGGGAAAGAGGCTCAGTTTTGGT
TTAAATATGGAGTAAGCCCTAAAGTAAGAGAATATATAGAAAGCAAAGGTGGGAAAGTTATATTGGGTATGGGGAATTAA