Detailed information of immunity protein


Summary

Immunity protein ID IMU00342 experimental
Cognate effector EFF01519 experimental
Related T6SS (Type) T6SS00367 insolico (Type i1)
Strain Escherichia coli O111:H- str. 11128
Replicon chromosome
Sequence Protein sequence (122 a.a.); Nucleotide sequence (366 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECO111_0593 (CTI3)
Coordinates (Strand) 632211..632576 (-)
NCBI ID 446014673
RefSeq NC_013364
Uniprot ID A0A027ZE20_ECOLX, A0A028DLQ1_ECOLX, A0A074ISQ1_ECOLX, A0A080G3V9_ECOLX, A0A0F3UVK4_ECOLX, C8UJN3_ECO1A, I2ULF1_ECOLX, K4W8Y7_ECOLX, K4XJR4_ECOLX
KEGG ID eoi:ECO111_0593
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-121 MSRYILIRGWFECDFEQVKKIKEANEEFFKHSEKYLLPENTKRLYLNGWCYPEYPINWVSVISLGVNINQIAFDYIKDMIVNVSKTERLDGYFRVNDDEDNLFLEWIVKDGYLEEIILSGS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9920 - -



  Protein sequence: 122 a.a.    .

>IMU00342 NC_013364:c632576-632211 [Escherichia coli O111:H- str. 11128]
MSRYILIRGWFECDFEQVKKIKEANEEFFKHSEKYLLPENTKRLYLNGWCYPEYPINWVSVISLGVNINQIAFDYIKDMI
VNVSKTERLDGYFRVNDDEDNLFLEWIVKDGYLEEIILSGS*

  Nucleotide sequence: 366 bp    .

>IMU00342 NC_013364:c632576-632211 [Escherichia coli O111:H- str. 11128]
ATGTCAAGATATATACTTATTAGAGGTTGGTTTGAGTGCGACTTTGAACAAGTAAAAAAAATAAAAGAAGCTAATGAAGA
ATTTTTCAAACATTCTGAAAAATATTTATTACCAGAAAACACGAAACGACTTTATTTAAATGGGTGGTGTTACCCAGAAT
ATCCTATCAACTGGGTTAGCGTTATTTCCTTAGGTGTTAATATAAATCAAATTGCATTTGATTATATAAAAGACATGATT
GTAAATGTTTCAAAAACTGAAAGATTGGATGGTTATTTTCGTGTGAATGATGATGAAGATAATTTATTCTTAGAATGGAT
TGTAAAAGATGGTTATTTAGAGGAAATAATTTTGTCTGGTTCATAA