Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AAIB43_RS06620 | Genome accession | NZ_CP154366 |
| Coordinates | 1370924..1371241 (+) | Length | 105 a.a. |
| NCBI ID | WP_343323137.1 | Uniprot ID | - |
| Organism | Staphylococcus xylosus strain 14BME10 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1365924..1376241
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAIB43_RS06590 (AAIB43_06595) | - | 1366274..1366468 (+) | 195 | WP_042363548.1 | YqgQ family protein | - |
| AAIB43_RS06595 (AAIB43_06600) | - | 1366858..1367844 (+) | 987 | WP_029377187.1 | glucokinase | - |
| AAIB43_RS06600 (AAIB43_06605) | - | 1367844..1368167 (+) | 324 | WP_042362616.1 | MTH1187 family thiamine-binding protein | - |
| AAIB43_RS06605 (AAIB43_06610) | - | 1368169..1368792 (+) | 624 | WP_042362617.1 | MBL fold metallo-hydrolase | - |
| AAIB43_RS06610 (AAIB43_06615) | comGA | 1368891..1369865 (+) | 975 | WP_069794318.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AAIB43_RS06615 (AAIB43_06620) | comGB | 1369837..1370904 (+) | 1068 | WP_069794319.1 | competence type IV pilus assembly protein ComGB | - |
| AAIB43_RS06620 (AAIB43_06625) | comGC | 1370924..1371241 (+) | 318 | WP_343323137.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AAIB43_RS06625 (AAIB43_06630) | comGD | 1371222..1371665 (+) | 444 | WP_225523058.1 | competence type IV pilus minor pilin ComGD | - |
| AAIB43_RS06630 (AAIB43_06635) | - | 1371652..1371951 (+) | 300 | WP_069794320.1 | hypothetical protein | - |
| AAIB43_RS06635 (AAIB43_06640) | comGF | 1371923..1372366 (+) | 444 | WP_069794321.1 | competence type IV pilus minor pilin ComGF | - |
| AAIB43_RS06640 (AAIB43_06645) | - | 1372531..1373046 (+) | 516 | WP_171031808.1 | shikimate kinase | - |
| AAIB43_RS06645 (AAIB43_06650) | gcvT | 1373234..1374325 (+) | 1092 | WP_069795626.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AAIB43_RS06650 (AAIB43_06655) | gcvPA | 1374343..1375695 (+) | 1353 | WP_042362625.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11848.89 Da Isoelectric Point: 8.8999
>NTDB_id=993072 AAIB43_RS06620 WP_343323137.1 1370924..1371241(+) (comGC) [Staphylococcus xylosus strain 14BME10]
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQYKSGALISINDGEAVAN
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQYKSGALISINDGEAVAN
Nucleotide
Download Length: 318 bp
>NTDB_id=993072 AAIB43_RS06620 WP_343323137.1 1370924..1371241(+) (comGC) [Staphylococcus xylosus strain 14BME10]
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATATAAGTCAGGTGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATATAAGTCAGGTGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
69.307 |
96.19 |
0.667 |
| comGC | Staphylococcus aureus MW2 |
69.307 |
96.19 |
0.667 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
43.396 |
100 |
0.438 |
| comGC/cglC | Streptococcus pneumoniae D39 |
42.453 |
100 |
0.429 |
| comGC/cglC | Streptococcus pneumoniae R6 |
42.453 |
100 |
0.429 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
42.453 |
100 |
0.429 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
42.453 |
100 |
0.429 |
| comGC/cglC | Streptococcus mitis SK321 |
42.453 |
100 |
0.429 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
46.154 |
86.667 |
0.4 |
| comYC | Streptococcus suis isolate S10 |
48.193 |
79.048 |
0.381 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
40.426 |
89.524 |
0.362 |
| comYC | Streptococcus mutans UA159 |
49.351 |
73.333 |
0.362 |
| comYC | Streptococcus mutans UA140 |
49.351 |
73.333 |
0.362 |