Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | GZ111_RS00500 | Genome accession | NZ_CP152420 |
| Coordinates | 98451..98762 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 17-021 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 93451..103762
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GZ111_RS00470 (GZ111_000470) | - | 94234..94437 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| GZ111_RS00475 (GZ111_000475) | - | 94434..95420 (+) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| GZ111_RS00480 (GZ111_000480) | - | 95420..95749 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| GZ111_RS00485 (GZ111_000485) | - | 95746..96369 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| GZ111_RS00490 (GZ111_000490) | comGA | 96421..97395 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| GZ111_RS00495 (GZ111_000495) | comGB | 97367..98437 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| GZ111_RS00500 (GZ111_000500) | comGC | 98451..98762 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GZ111_RS00505 (GZ111_000505) | comGD | 98740..99186 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| GZ111_RS00510 (GZ111_000510) | comGE | 99173..99472 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| GZ111_RS00515 (GZ111_000515) | comGF | 99390..99887 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| GZ111_RS00520 (GZ111_000520) | - | 99984..100130 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| GZ111_RS00525 (GZ111_000525) | - | 100120..100644 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| GZ111_RS00530 (GZ111_000530) | gcvT | 100803..101894 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GZ111_RS00535 (GZ111_000535) | gcvPA | 101914..103260 (+) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=989201 GZ111_RS00500 WP_000472256.1 98451..98762(+) (comGC) [Staphylococcus aureus strain 17-021]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=989201 GZ111_RS00500 WP_000472256.1 98451..98762(+) (comGC) [Staphylococcus aureus strain 17-021]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |