Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR26_RS07870 | Genome accession | NZ_CP150888 |
| Coordinates | 1633297..1633608 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN181 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1628297..1638608
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR26_RS07835 (UXR26_07835) | gcvPA | 1628799..1630145 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR26_RS07840 (UXR26_07840) | gcvT | 1630165..1631256 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR26_RS07845 (UXR26_07845) | - | 1631415..1631939 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| UXR26_RS07850 (UXR26_07850) | - | 1631929..1632075 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| UXR26_RS07855 (UXR26_07855) | comGF | 1632172..1632669 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR26_RS07860 (UXR26_07860) | comGE | 1632587..1632886 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| UXR26_RS07865 (UXR26_07865) | comGD | 1632873..1633319 (-) | 447 | WP_341276500.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR26_RS07870 (UXR26_07870) | comGC | 1633297..1633608 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR26_RS07875 (UXR26_07875) | comGB | 1633622..1634692 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR26_RS07880 (UXR26_07880) | comGA | 1634664..1635638 (-) | 975 | WP_000697221.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR26_RS07885 (UXR26_07885) | - | 1635690..1636313 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR26_RS07890 (UXR26_07890) | - | 1636310..1636639 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR26_RS07895 (UXR26_07895) | - | 1636639..1637625 (-) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| UXR26_RS07900 (UXR26_07900) | - | 1637622..1637825 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=973490 UXR26_RS07870 WP_000472256.1 1633297..1633608(-) (comGC) [Staphylococcus aureus strain BSN181]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=973490 UXR26_RS07870 WP_000472256.1 1633297..1633608(-) (comGC) [Staphylococcus aureus strain BSN181]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |