Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC59_RS06640 | Genome accession | NZ_CP150769 |
| Coordinates | 1333523..1333834 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM20915 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1328523..1338834
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC59_RS06605 (WOC59_06590) | gcvPA | 1329025..1330371 (-) | 1347 | WP_117200971.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| WOC59_RS06610 (WOC59_06595) | gcvT | 1330391..1331482 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC59_RS06615 (WOC59_06600) | - | 1331641..1332165 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| WOC59_RS06620 (WOC59_06605) | - | 1332155..1332301 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC59_RS06625 (WOC59_06610) | comGF | 1332398..1332895 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC59_RS06630 (WOC59_06615) | comGE | 1332813..1333112 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC59_RS06635 (WOC59_06620) | comGD | 1333099..1333545 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC59_RS06640 (WOC59_06625) | comGC | 1333523..1333834 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC59_RS06645 (WOC59_06630) | comGB | 1333848..1334918 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC59_RS06650 (WOC59_06635) | comGA | 1334890..1335864 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC59_RS06655 (WOC59_06640) | - | 1335916..1336539 (-) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| WOC59_RS06660 (WOC59_06645) | - | 1336536..1336865 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC59_RS06665 (WOC59_06650) | - | 1336865..1337851 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC59_RS06670 (WOC59_06655) | - | 1337848..1338051 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=972266 WOC59_RS06640 WP_000472256.1 1333523..1333834(-) (comGC) [Staphylococcus aureus strain TUM20915]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=972266 WOC59_RS06640 WP_000472256.1 1333523..1333834(-) (comGC) [Staphylococcus aureus strain TUM20915]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |