Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC51_RS01795 | Genome accession | NZ_CP150767 |
| Coordinates | 397762..398073 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM20926 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 392762..403073
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC51_RS01760 (WOC51_01750) | gcvPA | 393264..394610 (-) | 1347 | WP_117200971.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| WOC51_RS01765 (WOC51_01755) | gcvT | 394630..395721 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC51_RS01770 (WOC51_01760) | - | 395880..396404 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| WOC51_RS01775 (WOC51_01765) | - | 396394..396540 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC51_RS01780 (WOC51_01770) | comGF | 396637..397134 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC51_RS01785 (WOC51_01775) | comGE | 397052..397351 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC51_RS01790 (WOC51_01780) | comGD | 397338..397784 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC51_RS01795 (WOC51_01785) | comGC | 397762..398073 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC51_RS01800 (WOC51_01790) | comGB | 398087..399157 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC51_RS01805 (WOC51_01795) | comGA | 399129..400103 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC51_RS01810 (WOC51_01800) | - | 400155..400778 (-) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| WOC51_RS01815 (WOC51_01805) | - | 400775..401104 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC51_RS01820 (WOC51_01810) | - | 401104..402090 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC51_RS01825 (WOC51_01815) | - | 402087..402290 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=972211 WOC51_RS01795 WP_000472256.1 397762..398073(-) (comGC) [Staphylococcus aureus strain TUM20926]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=972211 WOC51_RS01795 WP_000472256.1 397762..398073(-) (comGC) [Staphylococcus aureus strain TUM20926]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |