Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC65_RS07235 | Genome accession | NZ_CP150756 |
| Coordinates | 1443211..1443522 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22188 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1438211..1448522
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC65_RS07205 (WOC65_07195) | - | 1438994..1439197 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC65_RS07210 (WOC65_07200) | - | 1439194..1440180 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC65_RS07215 (WOC65_07205) | - | 1440180..1440509 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC65_RS07220 (WOC65_07210) | - | 1440506..1441129 (+) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| WOC65_RS07225 (WOC65_07215) | comGA | 1441181..1442155 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC65_RS07230 (WOC65_07220) | comGB | 1442127..1443197 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC65_RS07235 (WOC65_07225) | comGC | 1443211..1443522 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC65_RS07240 (WOC65_07230) | comGD | 1443500..1443946 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC65_RS07245 (WOC65_07235) | comGE | 1443933..1444232 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC65_RS07250 (WOC65_07240) | comGF | 1444150..1444647 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC65_RS07255 (WOC65_07245) | - | 1444744..1444890 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC65_RS07260 (WOC65_07250) | - | 1444880..1445404 (+) | 525 | WP_001015121.1 | shikimate kinase | - |
| WOC65_RS07265 (WOC65_07255) | gcvT | 1445563..1446654 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC65_RS07270 (WOC65_07260) | gcvPA | 1446674..1448020 (+) | 1347 | WP_117200971.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971925 WOC65_RS07235 WP_000472256.1 1443211..1443522(+) (comGC) [Staphylococcus aureus strain TUM22188]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971925 WOC65_RS07235 WP_000472256.1 1443211..1443522(+) (comGC) [Staphylococcus aureus strain TUM22188]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |