Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC45_RS00600 | Genome accession | NZ_CP150752 |
| Coordinates | 112008..112319 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22458 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 107008..117319
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC45_RS00570 (WOC45_00565) | - | 107791..107994 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC45_RS00575 (WOC45_00570) | - | 107991..108977 (+) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| WOC45_RS00580 (WOC45_00575) | - | 108977..109306 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC45_RS00585 (WOC45_00580) | - | 109303..109926 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| WOC45_RS00590 (WOC45_00585) | comGA | 109978..110952 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC45_RS00595 (WOC45_00590) | comGB | 110924..111994 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC45_RS00600 (WOC45_00595) | comGC | 112008..112319 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC45_RS00605 (WOC45_00600) | comGD | 112297..112743 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC45_RS00610 (WOC45_00605) | comGE | 112730..113029 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| WOC45_RS00615 (WOC45_00610) | comGF | 112947..113444 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC45_RS00620 (WOC45_00615) | - | 113541..113687 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| WOC45_RS00625 (WOC45_00620) | - | 113677..114201 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| WOC45_RS00630 (WOC45_00625) | gcvT | 114360..115451 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC45_RS00635 (WOC45_00630) | gcvPA | 115471..116817 (+) | 1347 | WP_063653170.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971820 WOC45_RS00600 WP_000472256.1 112008..112319(+) (comGC) [Staphylococcus aureus strain TUM22458]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971820 WOC45_RS00600 WP_000472256.1 112008..112319(+) (comGC) [Staphylococcus aureus strain TUM22458]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |