Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC43_RS10470 | Genome accession | NZ_CP150749 |
| Coordinates | 2108184..2108495 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22699 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2103184..2113495
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC43_RS10440 (WOC43_10440) | - | 2103967..2104170 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC43_RS10445 (WOC43_10445) | - | 2104167..2105153 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC43_RS10450 (WOC43_10450) | - | 2105153..2105482 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC43_RS10455 (WOC43_10455) | - | 2105479..2106102 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| WOC43_RS10460 (WOC43_10460) | comGA | 2106154..2107128 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC43_RS10465 (WOC43_10465) | comGB | 2107100..2108170 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC43_RS10470 (WOC43_10470) | comGC | 2108184..2108495 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC43_RS10475 (WOC43_10475) | comGD | 2108473..2108919 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC43_RS10480 (WOC43_10480) | comGE | 2108906..2109205 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC43_RS10485 (WOC43_10485) | comGF | 2109123..2109545 (+) | 423 | WP_258922346.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC43_RS10490 (WOC43_10490) | - | 2109623..2110795 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| WOC43_RS10495 (WOC43_10495) | - | 2110848..2110952 (+) | 105 | Protein_2020 | type IV pilus minor pilin ComGF family protein | - |
| WOC43_RS10500 (WOC43_10500) | - | 2111049..2111195 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC43_RS10505 (WOC43_10505) | - | 2111185..2111709 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| WOC43_RS10510 (WOC43_10510) | gcvT | 2111868..2112959 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971758 WOC43_RS10470 WP_000472256.1 2108184..2108495(+) (comGC) [Staphylococcus aureus strain TUM22699]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971758 WOC43_RS10470 WP_000472256.1 2108184..2108495(+) (comGC) [Staphylococcus aureus strain TUM22699]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |