Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC44_RS04545 | Genome accession | NZ_CP150737 |
| Coordinates | 842223..842534 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22723 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 837223..847534
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC44_RS04515 (WOC44_04515) | - | 838006..838209 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC44_RS04520 (WOC44_04520) | - | 838206..839192 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC44_RS04525 (WOC44_04525) | - | 839192..839521 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC44_RS04530 (WOC44_04530) | - | 839518..840141 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| WOC44_RS04535 (WOC44_04535) | comGA | 840193..841167 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC44_RS04540 (WOC44_04540) | comGB | 841139..842209 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC44_RS04545 (WOC44_04545) | comGC | 842223..842534 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC44_RS04550 (WOC44_04550) | comGD | 842512..842958 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC44_RS04555 (WOC44_04555) | comGE | 842945..843244 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC44_RS04560 (WOC44_04560) | comGF | 843162..843659 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC44_RS04565 (WOC44_04565) | - | 843756..843902 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC44_RS04570 (WOC44_04570) | - | 843892..844416 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| WOC44_RS04575 (WOC44_04575) | gcvT | 844575..845666 (+) | 1092 | WP_053872994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC44_RS04580 (WOC44_04580) | gcvPA | 845686..847032 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=971479 WOC44_RS04545 WP_000472256.1 842223..842534(+) (comGC) [Staphylococcus aureus strain TUM22723]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=971479 WOC44_RS04545 WP_000472256.1 842223..842534(+) (comGC) [Staphylococcus aureus strain TUM22723]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |