Detailed information NTG0971366

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: WOC72_RS13715
• Genome accession: NZ_CP150731
• Coordinates: 2756943..2757254 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain TUM22744
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2751943..2762254

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
WOC72_RS13680 (WOC72_13680)	gcvPA	2752445..2753791 (-)	1347	WP_117200971.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
WOC72_RS13685 (WOC72_13685)	gcvT	2753811..2754902 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
WOC72_RS13690 (WOC72_13690)	-	2755061..2755585 (-)	525	WP_001015121.1	shikimate kinase	-
WOC72_RS13695 (WOC72_13695)	-	2755575..2755721 (-)	147	WP_001789879.1	hypothetical protein	-
WOC72_RS13700 (WOC72_13700)	comGF	2755818..2756315 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
WOC72_RS13705 (WOC72_13705)	comGE	2756233..2756532 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
WOC72_RS13710 (WOC72_13710)	comGD	2756519..2756965 (-)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
WOC72_RS13715 (WOC72_13715)	comGC	2756943..2757254 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
WOC72_RS13720 (WOC72_13720)	comGB	2757268..2758338 (-)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
WOC72_RS13725 (WOC72_13725)	comGA	2758310..2759284 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
WOC72_RS13730 (WOC72_13730)	-	2759336..2759959 (-)	624	WP_001223010.1	MBL fold metallo-hydrolase	-
WOC72_RS13735 (WOC72_13735)	-	2759956..2760285 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
WOC72_RS13740 (WOC72_13740)	-	2760285..2761271 (-)	987	WP_000161314.1	ROK family glucokinase	-
WOC72_RS13745 (WOC72_13745)	-	2761268..2761471 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=971366 WOC72_RS13715 WP_000472256.1 2756943..2757254(-) (comGC) [Staphylococcus aureus strain TUM22744]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=971366 WOC72_RS13715 WP_000472256.1 2756943..2757254(-) (comGC) [Staphylococcus aureus strain TUM22744]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369