Detailed information NTG0962265

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: UXR22_RS08145
• Genome accession: NZ_CP149937
• Coordinates: 1657689..1658000 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain BSN124
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1652689..1663000

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
UXR22_RS08110 (UXR22_08110)	gcvPA	1653191..1654537 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
UXR22_RS08115 (UXR22_08115)	gcvT	1654557..1655648 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
UXR22_RS08120 (UXR22_08120)	-	1655807..1656331 (-)	525	WP_001015117.1	shikimate kinase	-
UXR22_RS08125 (UXR22_08125)	-	1656321..1656467 (-)	147	WP_001789879.1	hypothetical protein	-
UXR22_RS08130 (UXR22_08130)	comGF	1656564..1657061 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
UXR22_RS08135 (UXR22_08135)	comGE	1656979..1657278 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
UXR22_RS08140 (UXR22_08140)	comGD	1657265..1657711 (-)	447	WP_001791635.1	competence type IV pilus minor pilin ComGD	Machinery gene
UXR22_RS08145 (UXR22_08145)	comGC	1657689..1658000 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
UXR22_RS08150 (UXR22_08150)	comGB	1658014..1659084 (-)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
UXR22_RS08155 (UXR22_08155)	comGA	1659056..1660030 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
UXR22_RS08160 (UXR22_08160)	-	1660082..1660705 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
UXR22_RS08165 (UXR22_08165)	-	1660702..1661031 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
UXR22_RS08170 (UXR22_08170)	-	1661031..1662017 (-)	987	WP_000161314.1	ROK family glucokinase	-
UXR22_RS08175 (UXR22_08175)	-	1662014..1662217 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=962265 UXR22_RS08145 WP_000472256.1 1657689..1658000(-) (comGC) [Staphylococcus aureus strain BSN124]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=962265 UXR22_RS08145 WP_000472256.1 1657689..1658000(-) (comGC) [Staphylococcus aureus strain BSN124]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369