Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR27_RS07655 | Genome accession | NZ_CP149461 |
| Coordinates | 1587601..1587912 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN78 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1582601..1592912
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR27_RS07620 (UXR27_07620) | gcvPA | 1583103..1584449 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR27_RS07625 (UXR27_07625) | gcvT | 1584469..1585560 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR27_RS07630 (UXR27_07630) | - | 1585719..1586243 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| UXR27_RS07635 (UXR27_07635) | - | 1586233..1586379 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| UXR27_RS07640 (UXR27_07640) | comGF | 1586476..1586973 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR27_RS07645 (UXR27_07645) | comGE | 1586891..1587190 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| UXR27_RS07650 (UXR27_07650) | comGD | 1587177..1587623 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR27_RS07655 (UXR27_07655) | comGC | 1587601..1587912 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR27_RS07660 (UXR27_07660) | comGB | 1587926..1588996 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR27_RS07665 (UXR27_07665) | comGA | 1588968..1589942 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR27_RS07670 (UXR27_07670) | - | 1589994..1590617 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR27_RS07675 (UXR27_07675) | - | 1590614..1590943 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR27_RS07680 (UXR27_07680) | - | 1590943..1591929 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| UXR27_RS07685 (UXR27_07685) | - | 1591926..1592129 (-) | 204 | WP_000087562.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=959254 UXR27_RS07655 WP_000472256.1 1587601..1587912(-) (comGC) [Staphylococcus aureus strain BSN78]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=959254 UXR27_RS07655 WP_000472256.1 1587601..1587912(-) (comGC) [Staphylococcus aureus strain BSN78]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |