Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR49_RS07355 | Genome accession | NZ_CP147831 |
| Coordinates | 1538276..1538587 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN140 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1533276..1543587
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR49_RS07320 (UXR49_07320) | gcvPA | 1533778..1535124 (-) | 1347 | WP_000019681.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR49_RS07325 (UXR49_07325) | gcvT | 1535144..1536235 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR49_RS07330 (UXR49_07330) | - | 1536394..1536918 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| UXR49_RS07335 (UXR49_07335) | - | 1536908..1537054 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| UXR49_RS07340 (UXR49_07340) | comGF | 1537151..1537648 (-) | 498 | WP_020978197.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR49_RS07345 (UXR49_07345) | comGE | 1537566..1537865 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| UXR49_RS07350 (UXR49_07350) | comGD | 1537852..1538298 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR49_RS07355 (UXR49_07355) | comGC | 1538276..1538587 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR49_RS07360 (UXR49_07360) | comGB | 1538601..1539671 (-) | 1071 | WP_000776401.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR49_RS07365 (UXR49_07365) | comGA | 1539643..1540617 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR49_RS07370 (UXR49_07370) | - | 1540669..1541292 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR49_RS07375 (UXR49_07375) | - | 1541289..1541618 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR49_RS07380 (UXR49_07380) | - | 1541618..1542604 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| UXR49_RS07385 (UXR49_07385) | - | 1542601..1542804 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=948851 UXR49_RS07355 WP_000472256.1 1538276..1538587(-) (comGC) [Staphylococcus aureus strain BSN140]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=948851 UXR49_RS07355 WP_000472256.1 1538276..1538587(-) (comGC) [Staphylococcus aureus strain BSN140]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |