Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VW858_RS13740 | Genome accession | NZ_CP142811 |
| Coordinates | 2800138..2800596 (-) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain JF1A-4353 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2743778..2807527 | 2800138..2800596 | within | 0 |
Gene organization within MGE regions
Location: 2743778..2807527
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW858_RS13460 (VW858_13460) | - | 2744481..2745614 (-) | 1134 | WP_002377959.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| VW858_RS13465 (VW858_13465) | - | 2745717..2746787 (-) | 1071 | WP_010710139.1 | ammonium transporter | - |
| VW858_RS13470 (VW858_13470) | - | 2746981..2747384 (-) | 404 | Protein_2637 | NusG domain II-containing protein | - |
| VW858_RS13475 (VW858_13475) | - | 2747436..2747813 (-) | 378 | WP_002382844.1 | hypothetical protein | - |
| VW858_RS13480 (VW858_13480) | rpmF | 2747835..2748008 (-) | 174 | WP_002358539.1 | 50S ribosomal protein L32 | - |
| VW858_RS13485 (VW858_13485) | - | 2748347..2749402 (+) | 1056 | WP_002401430.1 | YibE/F family protein | - |
| VW858_RS13490 (VW858_13490) | - | 2749399..2750163 (+) | 765 | WP_002358536.1 | YibE/F family protein | - |
| VW858_RS13495 (VW858_13495) | - | 2750796..2751278 (-) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
| VW858_RS13500 (VW858_13500) | - | 2751289..2752791 (-) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| VW858_RS13505 (VW858_13505) | - | 2752784..2753491 (-) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| VW858_RS13510 (VW858_13510) | - | 2753647..2754465 (+) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| VW858_RS13515 (VW858_13515) | - | 2754921..2755103 (-) | 183 | WP_002358529.1 | hypothetical protein | - |
| VW858_RS13520 (VW858_13520) | - | 2755212..2755831 (-) | 620 | Protein_2647 | recombinase family protein | - |
| VW858_RS13525 (VW858_13525) | - | 2756015..2756635 (+) | 621 | WP_033591050.1 | recombinase family protein | - |
| VW858_RS13530 (VW858_13530) | - | 2756681..2757418 (-) | 738 | WP_002401428.1 | hypothetical protein | - |
| VW858_RS13535 (VW858_13535) | - | 2757406..2757507 (+) | 102 | Protein_2650 | IS30 family transposase | - |
| VW858_RS13540 (VW858_13540) | - | 2757643..2758059 (-) | 417 | WP_002358522.1 | hypothetical protein | - |
| VW858_RS13545 (VW858_13545) | - | 2758189..2759397 (-) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| VW858_RS13550 (VW858_13550) | - | 2759597..2765464 (-) | 5868 | WP_202580324.1 | Rib/alpha-like domain-containing protein | - |
| VW858_RS13555 (VW858_13555) | - | 2765739..2766275 (-) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| VW858_RS13560 (VW858_13560) | - | 2766304..2766495 (-) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| VW858_RS13565 (VW858_13565) | amaP | 2766512..2767078 (-) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| VW858_RS13570 (VW858_13570) | - | 2767348..2767635 (-) | 288 | WP_306418522.1 | S41 family peptidase | - |
| VW858_RS13575 (VW858_13575) | - | 2767649..2768230 (-) | 582 | WP_002401490.1 | hypothetical protein | - |
| VW858_RS13580 (VW858_13580) | - | 2768308..2768775 (-) | 468 | WP_002370921.1 | hypothetical protein | - |
| VW858_RS13585 (VW858_13585) | - | 2769212..2769775 (-) | 564 | WP_002370925.1 | hypothetical protein | - |
| VW858_RS13590 (VW858_13590) | - | 2770128..2771111 (-) | 984 | WP_002368282.1 | site-2 protease family protein | - |
| VW858_RS13595 (VW858_13595) | - | 2771112..2772350 (-) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| VW858_RS13600 (VW858_13600) | - | 2772347..2774491 (-) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| VW858_RS13605 (VW858_13605) | - | 2774503..2777484 (-) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| VW858_RS13610 (VW858_13610) | cylL-S | 2777545..2777736 (-) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| VW858_RS13615 (VW858_13615) | cylL-L | 2777770..2777976 (-) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| VW858_RS13620 (VW858_13620) | cylR2 | 2778380..2778580 (+) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| VW858_RS13625 (VW858_13625) | - | 2778918..2779337 (-) | 420 | WP_002370932.1 | hypothetical protein | - |
| VW858_RS13630 (VW858_13630) | - | 2779405..2780049 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| VW858_RS13635 (VW858_13635) | bsh | 2780273..2781247 (+) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| VW858_RS13640 (VW858_13640) | - | 2781916..2782524 (-) | 609 | Protein_2671 | IS6 family transposase | - |
| VW858_RS13645 (VW858_13645) | - | 2782556..2782741 (-) | 186 | WP_002358660.1 | hypothetical protein | - |
| VW858_RS13650 (VW858_13650) | - | 2782831..2783100 (+) | 270 | Protein_2673 | LPXTG cell wall anchor domain-containing protein | - |
| VW858_RS13655 (VW858_13655) | - | 2783228..2784166 (+) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| VW858_RS13660 (VW858_13660) | - | 2784192..2785229 (+) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| VW858_RS13665 (VW858_13665) | - | 2785534..2786419 (-) | 886 | Protein_2676 | IS256 family transposase | - |
| VW858_RS13670 (VW858_13670) | - | 2786549..2787193 (+) | 645 | WP_002289351.1 | IS6 family transposase | - |
| VW858_RS13675 (VW858_13675) | - | 2787384..2787659 (-) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| VW858_RS13680 (VW858_13680) | - | 2787652..2787918 (-) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| VW858_RS13685 (VW858_13685) | - | 2788029..2788613 (-) | 585 | WP_218399387.1 | thermonuclease family protein | - |
| VW858_RS13690 (VW858_13690) | - | 2788637..2789053 (-) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| VW858_RS13695 (VW858_13695) | - | 2789129..2789377 (-) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| VW858_RS13700 (VW858_13700) | - | 2789390..2789890 (-) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| VW858_RS13705 (VW858_13705) | - | 2789923..2790189 (-) | 267 | WP_002377947.1 | hypothetical protein | - |
| VW858_RS13710 (VW858_13710) | - | 2790781..2791269 (-) | 489 | WP_010710133.1 | hypothetical protein | - |
| VW858_RS13715 (VW858_13715) | - | 2791275..2792060 (-) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| VW858_RS13720 (VW858_13720) | - | 2792583..2794841 (-) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| VW858_RS13725 (VW858_13725) | - | 2794828..2797173 (-) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| VW858_RS13730 (VW858_13730) | - | 2797186..2797584 (-) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| VW858_RS13735 (VW858_13735) | - | 2797541..2800033 (-) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| VW858_RS13740 (VW858_13740) | ssb | 2800138..2800596 (-) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| VW858_RS13745 (VW858_13745) | - | 2800691..2801173 (-) | 483 | WP_002377938.1 | hypothetical protein | - |
| VW858_RS13750 (VW858_13750) | - | 2801205..2801594 (-) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| VW858_RS13755 (VW858_13755) | - | 2801594..2801854 (-) | 261 | WP_010706916.1 | hypothetical protein | - |
| VW858_RS13760 (VW858_13760) | - | 2801859..2802893 (-) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| VW858_RS13765 (VW858_13765) | - | 2802886..2803200 (-) | 315 | WP_002360796.1 | hypothetical protein | - |
| VW858_RS13770 (VW858_13770) | - | 2803200..2803616 (-) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| VW858_RS13775 (VW858_13775) | - | 2803600..2804217 (-) | 618 | WP_002377936.1 | hypothetical protein | - |
| VW858_RS13780 (VW858_13780) | - | 2804220..2805490 (-) | 1271 | Protein_2699 | CHAP domain-containing protein | - |
| VW858_RS13785 (VW858_13785) | - | 2805516..2806376 (-) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| VW858_RS13790 (VW858_13790) | - | 2806396..2807274 (-) | 879 | WP_002377931.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=926980 VW858_RS13740 WP_002365911.1 2800138..2800596(-) (ssb) [Enterococcus faecalis strain JF1A-4353]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=926980 VW858_RS13740 WP_002365911.1 2800138..2800596(-) (ssb) [Enterococcus faecalis strain JF1A-4353]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |