Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VW859_RS01945 | Genome accession | NZ_CP142809 |
| Coordinates | 379344..379802 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain KS2H-124 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 370932..430072 | 379344..379802 | within | 0 |
Gene organization within MGE regions
Location: 370932..430072
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW859_RS01880 (VW859_01880) | prgU | 371485..371841 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| VW859_RS01885 (VW859_01885) | - | 371863..372249 (+) | 387 | WP_002377929.1 | hypothetical protein | - |
| VW859_RS01890 (VW859_01890) | - | 372395..372655 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| VW859_RS01895 (VW859_01895) | - | 372666..373544 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| VW859_RS01900 (VW859_01900) | - | 373564..374424 (+) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| VW859_RS01905 (VW859_01905) | - | 374450..375720 (+) | 1271 | Protein_351 | CHAP domain-containing protein | - |
| VW859_RS01910 (VW859_01910) | - | 375723..376340 (+) | 618 | WP_002377936.1 | hypothetical protein | - |
| VW859_RS01915 (VW859_01915) | - | 376324..376740 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| VW859_RS01920 (VW859_01920) | - | 376740..377054 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| VW859_RS01925 (VW859_01925) | - | 377047..378081 (+) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| VW859_RS01930 (VW859_01930) | - | 378071..378346 (+) | 276 | WP_002360793.1 | hypothetical protein | - |
| VW859_RS01935 (VW859_01935) | - | 378346..378735 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| VW859_RS01940 (VW859_01940) | - | 378767..379249 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| VW859_RS01945 (VW859_01945) | ssb | 379344..379802 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| VW859_RS01950 (VW859_01950) | - | 379907..382399 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| VW859_RS01955 (VW859_01955) | - | 382356..382754 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| VW859_RS01960 (VW859_01960) | - | 382767..385107 (+) | 2341 | Protein_362 | CD3337/EF1877 family mobilome membrane protein | - |
| VW859_RS01965 (VW859_01965) | - | 385094..387352 (+) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| VW859_RS01970 (VW859_01970) | - | 387875..388660 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| VW859_RS01975 (VW859_01975) | - | 388666..389154 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| VW859_RS01980 (VW859_01980) | - | 389746..390012 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| VW859_RS01985 (VW859_01985) | - | 390045..390545 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| VW859_RS01990 (VW859_01990) | - | 390558..390806 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| VW859_RS01995 (VW859_01995) | - | 390882..391298 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| VW859_RS02000 (VW859_02000) | - | 391322..391906 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| VW859_RS02005 (VW859_02005) | - | 392017..392283 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| VW859_RS02010 (VW859_02010) | - | 392276..392551 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| VW859_RS02015 (VW859_02015) | - | 392742..393386 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| VW859_RS02020 (VW859_02020) | - | 393519..394401 (+) | 883 | Protein_374 | IS256 family transposase | - |
| VW859_RS02025 (VW859_02025) | - | 394706..395743 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| VW859_RS02030 (VW859_02030) | - | 395769..396707 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| VW859_RS02035 (VW859_02035) | - | 396835..397104 (-) | 270 | Protein_377 | LPXTG cell wall anchor domain-containing protein | - |
| VW859_RS02040 (VW859_02040) | - | 397194..397379 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| VW859_RS02045 (VW859_02045) | - | 397411..398019 (+) | 609 | Protein_379 | IS6 family transposase | - |
| VW859_RS02050 (VW859_02050) | bsh | 398688..399662 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| VW859_RS02055 (VW859_02055) | - | 399886..400530 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| VW859_RS02060 (VW859_02060) | - | 400703..401017 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| VW859_RS02065 (VW859_02065) | cylR2 | 401355..401555 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| VW859_RS02070 (VW859_02070) | cylL-L | 401959..402165 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| VW859_RS02075 (VW859_02075) | cylL-S | 402199..402390 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| VW859_RS02080 (VW859_02080) | - | 402451..405432 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| VW859_RS02085 (VW859_02085) | - | 405444..407588 (+) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| VW859_RS02090 (VW859_02090) | - | 407585..408823 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| VW859_RS02095 (VW859_02095) | - | 408896..409807 (+) | 912 | WP_227264185.1 | site-2 protease family protein | - |
| VW859_RS02100 (VW859_02100) | - | 410160..410723 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| VW859_RS02105 (VW859_02105) | - | 411160..411627 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| VW859_RS02110 (VW859_02110) | - | 411705..412286 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| VW859_RS02115 (VW859_02115) | - | 412381..412587 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
| VW859_RS02120 (VW859_02120) | amaP | 412857..413423 (+) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| VW859_RS02125 (VW859_02125) | - | 413440..413631 (+) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| VW859_RS02130 (VW859_02130) | - | 413660..414196 (+) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| VW859_RS02135 (VW859_02135) | - | 414471..420092 (+) | 5622 | WP_108095647.1 | Rib/alpha-like domain-containing protein | - |
| VW859_RS02140 (VW859_02140) | - | 420292..421500 (+) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| VW859_RS02145 (VW859_02145) | - | 421630..422046 (+) | 417 | WP_002358522.1 | hypothetical protein | - |
| VW859_RS02150 (VW859_02150) | - | 422182..422283 (-) | 102 | Protein_400 | IS30 family transposase | - |
| VW859_RS02155 (VW859_02155) | - | 422271..423008 (+) | 738 | WP_002401428.1 | hypothetical protein | - |
| VW859_RS02160 (VW859_02160) | - | 423054..423674 (-) | 621 | WP_033591050.1 | recombinase family protein | - |
| VW859_RS02165 (VW859_02165) | - | 423858..424477 (+) | 620 | Protein_403 | recombinase family protein | - |
| VW859_RS02170 (VW859_02170) | - | 424616..424768 (+) | 153 | WP_229204429.1 | hypothetical protein | - |
| VW859_RS02175 (VW859_02175) | - | 425224..426042 (-) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| VW859_RS02180 (VW859_02180) | - | 426198..426905 (+) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| VW859_RS02185 (VW859_02185) | - | 426898..428400 (+) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| VW859_RS02190 (VW859_02190) | - | 428411..428893 (+) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=926875 VW859_RS01945 WP_002365911.1 379344..379802(+) (ssb) [Enterococcus faecalis strain KS2H-124]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=926875 VW859_RS01945 WP_002365911.1 379344..379802(+) (ssb) [Enterococcus faecalis strain KS2H-124]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |