Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | VW863_RS01945 | Genome accession | NZ_CP142808 |
| Coordinates | 379134..379592 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain KS3H-124 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 370722..429862 | 379134..379592 | within | 0 |
Gene organization within MGE regions
Location: 370722..429862
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VW863_RS01880 (VW863_01880) | prgU | 371275..371631 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| VW863_RS01885 (VW863_01885) | - | 371653..372039 (+) | 387 | WP_002377929.1 | hypothetical protein | - |
| VW863_RS01890 (VW863_01890) | - | 372185..372445 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| VW863_RS01895 (VW863_01895) | - | 372456..373334 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| VW863_RS01900 (VW863_01900) | - | 373354..374214 (+) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| VW863_RS01905 (VW863_01905) | - | 374240..375510 (+) | 1271 | Protein_351 | CHAP domain-containing protein | - |
| VW863_RS01910 (VW863_01910) | - | 375513..376130 (+) | 618 | WP_002377936.1 | hypothetical protein | - |
| VW863_RS01915 (VW863_01915) | - | 376114..376530 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| VW863_RS01920 (VW863_01920) | - | 376530..376844 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| VW863_RS01925 (VW863_01925) | - | 376837..377871 (+) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| VW863_RS01930 (VW863_01930) | - | 377861..378136 (+) | 276 | WP_002360793.1 | hypothetical protein | - |
| VW863_RS01935 (VW863_01935) | - | 378136..378525 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| VW863_RS01940 (VW863_01940) | - | 378557..379039 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| VW863_RS01945 (VW863_01945) | ssb | 379134..379592 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| VW863_RS01950 (VW863_01950) | - | 379697..382189 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| VW863_RS01955 (VW863_01955) | - | 382146..382544 (+) | 399 | WP_002370287.1 | lipocalin-like domain-containing protein | - |
| VW863_RS01960 (VW863_01960) | - | 382557..384897 (+) | 2341 | Protein_362 | CD3337/EF1877 family mobilome membrane protein | - |
| VW863_RS01965 (VW863_01965) | - | 384884..387142 (+) | 2259 | WP_010710132.1 | type IV secretory system conjugative DNA transfer family protein | - |
| VW863_RS01970 (VW863_01970) | - | 387665..388450 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| VW863_RS01975 (VW863_01975) | - | 388456..388944 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| VW863_RS01980 (VW863_01980) | - | 389536..389802 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| VW863_RS01985 (VW863_01985) | - | 389835..390335 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| VW863_RS01990 (VW863_01990) | - | 390348..390596 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| VW863_RS01995 (VW863_01995) | - | 390672..391088 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| VW863_RS02000 (VW863_02000) | - | 391112..391696 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| VW863_RS02005 (VW863_02005) | - | 391807..392073 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| VW863_RS02010 (VW863_02010) | - | 392066..392341 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| VW863_RS02015 (VW863_02015) | - | 392532..393176 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| VW863_RS02020 (VW863_02020) | - | 393309..394191 (+) | 883 | Protein_374 | IS256 family transposase | - |
| VW863_RS02025 (VW863_02025) | - | 394496..395533 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| VW863_RS02030 (VW863_02030) | - | 395559..396497 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| VW863_RS02035 (VW863_02035) | - | 396625..396894 (-) | 270 | Protein_377 | LPXTG cell wall anchor domain-containing protein | - |
| VW863_RS02040 (VW863_02040) | - | 396984..397169 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| VW863_RS02045 (VW863_02045) | - | 397201..397809 (+) | 609 | Protein_379 | IS6 family transposase | - |
| VW863_RS02050 (VW863_02050) | bsh | 398478..399452 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| VW863_RS02055 (VW863_02055) | - | 399676..400320 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| VW863_RS02060 (VW863_02060) | - | 400493..400807 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| VW863_RS02065 (VW863_02065) | cylR2 | 401145..401345 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| VW863_RS02070 (VW863_02070) | cylL-L | 401749..401955 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| VW863_RS02075 (VW863_02075) | cylL-S | 401989..402180 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| VW863_RS02080 (VW863_02080) | - | 402241..405222 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| VW863_RS02085 (VW863_02085) | - | 405234..407378 (+) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| VW863_RS02090 (VW863_02090) | - | 407375..408613 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| VW863_RS02095 (VW863_02095) | - | 408686..409597 (+) | 912 | WP_227264185.1 | site-2 protease family protein | - |
| VW863_RS02100 (VW863_02100) | - | 409950..410513 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| VW863_RS02105 (VW863_02105) | - | 410950..411417 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| VW863_RS02110 (VW863_02110) | - | 411495..412076 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| VW863_RS02115 (VW863_02115) | - | 412171..412377 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
| VW863_RS02120 (VW863_02120) | amaP | 412647..413213 (+) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| VW863_RS02125 (VW863_02125) | - | 413230..413421 (+) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| VW863_RS02130 (VW863_02130) | - | 413450..413986 (+) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| VW863_RS02135 (VW863_02135) | - | 414261..419882 (+) | 5622 | WP_108095647.1 | Rib/alpha-like domain-containing protein | - |
| VW863_RS02140 (VW863_02140) | - | 420082..421290 (+) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| VW863_RS02145 (VW863_02145) | - | 421420..421836 (+) | 417 | WP_002358522.1 | hypothetical protein | - |
| VW863_RS02150 (VW863_02150) | - | 421972..422073 (-) | 102 | Protein_400 | IS30 family transposase | - |
| VW863_RS02155 (VW863_02155) | - | 422061..422798 (+) | 738 | WP_002401428.1 | hypothetical protein | - |
| VW863_RS02160 (VW863_02160) | - | 422844..423464 (-) | 621 | WP_033591050.1 | recombinase family protein | - |
| VW863_RS02165 (VW863_02165) | - | 423648..424267 (+) | 620 | Protein_403 | recombinase family protein | - |
| VW863_RS02170 (VW863_02170) | - | 424406..424558 (+) | 153 | WP_229204429.1 | hypothetical protein | - |
| VW863_RS02175 (VW863_02175) | - | 425014..425832 (-) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| VW863_RS02180 (VW863_02180) | - | 425988..426695 (+) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| VW863_RS02185 (VW863_02185) | - | 426688..428190 (+) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| VW863_RS02190 (VW863_02190) | - | 428201..428683 (+) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=926837 VW863_RS01945 WP_002365911.1 379134..379592(+) (ssb) [Enterococcus faecalis strain KS3H-124]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=926837 VW863_RS01945 WP_002365911.1 379134..379592(+) (ssb) [Enterococcus faecalis strain KS3H-124]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |